Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  GPCR Peptide Ligands  >  Glucagon  >>  Glucagon-Like Peptide 1, GLP-1 amide, human

Product Name Glucagon - Like Peptide 1, GLP - 1 amide, human
Size 1 mg
Catalog # 22461
US$ $335
Description

This peptide, formed by cleavage of two basic residues, is an endogenous peptide secreted into the circulation by intestinal L cells. A potent glucose-dependent insulinotropic hormone, it has important actions on gastric motility, on the suppression of plasma glucagon levels and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. It potentiates insulin secretion by pancreatic A-cells in a glucose-dependent manner and inhibits gastric emptying and acid secretion.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: Drucker, D. et al. Proc. Natl. Acad. Sci. USA 84, 3434 (1987); Kieffer, T. and J. Habener, Endo. Rev. 20, 876 (1999).
Molecular Weight 4111.5
Sequence
(One-Letter Code)
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence
(Three-Letter Code)
H - His - Asp - Glu - Phe - Glu - Arg - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2
     
  < Back