Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  GPCR Peptide Ligands  >  Glucagon  >>  Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeled

Product Name Glucagon - Like Peptide 1, GLP - 1 amide, human, FAM - labeled
FAM - HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
Size 1 mg
Catalog # AS-23607
US$ $484
Description

This is a fluorescent (FAM)-labeled Glucagon-like peptide, Abs/Em=494/521 nm.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4469.8
Sequence
(One-Letter Code)
FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence
(Three-Letter Code)
FAM - His - Asp - Glu - Phe - Glu - Arg - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2
     
  < Back