Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  GPCR Peptide Ligands  >  Glucagon  >>  Glucagon-Like Peptide 1, GLP-1 (7-37)

Product Name Glucagon - Like Peptide 1, GLP - 1 (7 - 37)
Size 0.5 mg
Catalog # 20761
US$ $154
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: Brubaker, P. and D. Drucker, Receptors Channels 8, 179 (2002); Leonova, J. et al. Am. J. Physiol. Cell Physiol. 281, C1495 (2001); Drucker, D. et al. Proc. Natl. Acad. Sci. USA 84, 3434 (1987); Rönnbäck, L. and E. Hansson, J. Neuroinflam. 1, 22 (2004); Rothstein JD. et al. Neuron. 16, 675 (1996); Sonnewald, U. et al. Pharmacol. 3011 (2002).
Molecular Weight 3355.7
Sequence
(One-Letter Code)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Sequence
(Three-Letter Code)
H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - Gly - OH
     
  < Back