Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  GPCR Peptide Ligands  >  PACAPs  >>  PACAP (1-27), amide, human, ovine, rat

Product Name PACAP (1 - 27), amide, human, ovine, rat
HSDGIFTDSYSRYRKQMAVKKYLAAVL - NH2
Size 0.5 mg
Catalog # AS-22527
US$ $132
Description

PACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.

Storage -20C
References Ref: Miyata, A. et al. BBRC 164, 567(1998); Chik, C. et al. J. Neurochem. 67, 1005 (1996).
Molecular Weight 3147.7
Sequence
(One-Letter Code)
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Sequence
(Three-Letter Code)
H - His - Ser - Asp - Gly - Ile - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - NH2
     
  < Back