This is a truncated peptide of native rat amylin. In-vivo and in-vitro studies suggest that it acts as a specific amylin antagonist. In isolated soleus muscle, it blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin-resistant rats. It also elicits a significant alteration of in-vivo lipid metabolism.
Storage
-20°C
References
Ref: Deems, RO. et al. Biochem. Biophys. Res. Commun. 181, 116 (1991); Hettiarachchi, M. et al. Am. J. Physiol. Endocrinol. Metab. 273, E859 (1997).
Molecular Weight
3200.6
Sequence (One-Letter Code)
ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
Sequence (Three-Letter Code)
H - Ala - Thr - Gln - Arg - Leu - Ala - Asn - Phe - Leu - Val - Arg - Ser - Ser - Asn - Asn - Leu - Gly - Pro - Val - Leu - Pro - Pro - Thr - Asn - Val - Gly - Ser - Asn - Thr - Tyr - NH2
