Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  GPCR Peptide Ligands  >  Adrenomedullin  >>  Adrenomedullin (22-52), human

Product Name Adrenomedullin (22 - 52), human
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY - NH2
Size 0.5 mg
Catalog # AS-60449
US$ $181
Description

AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.

Storage -20C
References Ref: Hyvelin, JM. et al. J. Card Surg. 17, 328 (2002); Ziolkowska, A. et al. Int. J. Mol. Med. 11, 613 (2003); Nishimatsu, H. et al. Hypertens. Res. 26 Suppl, S79 (2003).
Molecular Weight 3576
Sequence
(One-Letter Code)
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Sequence
(Three-Letter Code)
H - Thr - Val - Gln - Lys - Leu - Ala - His - Gln - Ile - Tyr - Gln - Phe - Thr - Asp - Lys - Asp - Lys - Asp - Asn - Val - Ala - Pro - Arg - Ser - Lys - Ile - Ser - Pro - Gln - Gly - Tyr - NH2
     
  < Back