Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cyclic Peptides  >   Disulfide Cyclized Peptides  >>  Amylin (1-37), rat, mouse

Product Name Amylin (1 - 37), rat, mouse
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
Size 1 mg
Catalog # AS-60253-1
US$ $479
Purity % Peak Area By HPLC ≥ 95%
Description

Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.

Detailed Information Datasheet
Storage -20C
References Westermark, P. et al. Proc Natl Acad Sci U S A 87, 5036 (1990); Williamson, JA. and AD. Miranker. Protein Sci 16, 110 (2007). doi: 10.1110/ps.062486907.
Molecular Weight 3920.5
Sequence
(One-Letter Code)
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: 2-7)
Sequence
(Three-Letter Code)
H - Lys - Cys - Asn - Thr - Ala - Thr - Cys - Ala - Thr - Gln - Arg - Leu - Ala - Asn - Phe - Leu - Val - Arg - Ser - Ser - Asn - Asn - Leu - Gly - Pro - Val - Leu - Pro - Pro - Thr - Asn - Val - Gly - Ser - Asn - Thr - Tyr - NH2 (Disulfide bridge: 2 - 7)
     
  < Back