Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Stay Logged In

Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cyclic Peptides  >   Disulfide Cyclized Peptides  >>  CART (55-102), human

Product Name CART (55 - 102), human
VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge: 74 - 94, 68 - 86, and 88 - 101)
Size 0.1 mg
Catalog # 24154
US$ $457
Purity % Peak Area By HPLC ≥ 95%

This peptide is a food-intake inhibitor.

Storage -20C
Molecular Weight 5245.2
(One-Letter Code)
(Three-Letter Code)
H - Val - Pro - Ile - Tyr - Glu - Lys - Lys - Tyr - Gly - Gln - Val - Pro - Met - Cys - Asp - Ala - Gly - Glu - Gln - Cys - Ala - Val - Arg - Lys - Gly - Ala - Arg - Ile - Gly - Lys - Leu - Cys - Asp - Cys - Pro - Arg - Gly - Thr - Ser - Cys - Asn - Ser - Phe - Leu - Leu - Lys - Cys - Leu - OH (Disulfide bridge: 74 - 94, 68 - 86, and 88 - 101)
  < Back