Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cyclic Peptides  >   Disulfide Cyclized Peptides  >>  CART (55-102), rat

Product Name CART (55 - 102), rat
IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge: 74 - 94, 68 - 86, and 88 - 101)
Size 0.1 mg
Catalog # 24156
US$ $457
Purity % Peak Area By HPLC ≥ 95%
Description

Cocaine- and amphetamine-regulated transcript (CART) peptides (55 to 102 and 62 to 102) are neurotransmitters with important roles in a number of physiologic processes. CART 55 to 102 blunts some of the behavioral effects of cocaine and dopamine (DA). Infusion of CART (55-102) affects body weight homeostasis in rats. CART also produces anxiety-like behavior in rodents.

Storage -20C
References Ref: Kuhar, M. et al. AAPS J. 7, 25 (2005) Rohner, F. et al. Int. J. Obes. Relat. Metab. Disord. 26, 143 (2002); Chaki, S. et al. Eur. J. Pharmacol. 464, 49 (2003).
Molecular Weight 5259.3
Sequence
(One-Letter Code)
IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge: 74-94, 68-86, and 88-101)
Sequence
(Three-Letter Code)
H - Ile - Pro - Ile - Tyr - Glu - Lys - Lys - Tyr - Gly - Gln - Val - Pro - Met - Cys - Asp - Ala - Gly - Glu - Gln - Cys - Ala - Val - Arg - Lys - Gly - Ala - Arg - Ile - Gly - Lys - Leu - Cys - Asp - Cys - Pro - Arg - Gly - Thr - Ser - Cys - Asn - Ser - Phe - Leu - Leu - Lys - Cys - Leu - OH (Disulfide bridge: 74 - 94, 68 - 86, and 88 - 101)
     
  < Back