Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Stay Logged In

Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cyclic Peptides  >   Disulfide Cyclized Peptides  >>  hBD-1, β-Defensin-1, human

Product Name hBD - 1, β - Defensin - 1, human
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5 - 34, 12 - 27, 17 - 35)
Size 0.1 mg
Catalog # AS-60740
US$ $303
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Storage -20C
Molecular Weight 3929.6
(One-Letter Code)
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)
(Three-Letter Code)
H - Asp - His - Tyr - Asn - Cys - Val - Ser - Ser - Gly - Gly - Gln - Cys - Leu - Tyr - Ser - Ala - Cys - Pro - Ile - Phe - Thr - Lys - Ile - Gln - Gly - Thr - Cys - Tyr - Arg - Gly - Lys - Ala - Lys - Cys - Cys - Lys - OH (Disulfide bridge: 5 - 34, 12 - 27, 17 - 35)
Product Citations Kooi, C. & Sokol, PA. (2009). Burkholderia cenocepacia zinc metalloproteases influence resistance to antimicrobial peptides. Microbiol. doi:10.1099/mic.0.028969-0.
Gryllos, I. et al. (2008). Induction of group A Streptococcus virulence by a human antimicrobial peptide. PNAS 105, 16755.
  < Back