Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cyclic Peptides  >   Disulfide Cyclized Peptides  >>  BNP-45 (51-95), rat, 5K Cardiac Natriuretic Peptide

Product Name BNP - 45 (51 - 95), rat, 5K Cardiac Natriuretic Peptide
SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
Size 0.5 mg
Catalog # AS-61153
US$ $303
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 5040.8
Sequence
(One-Letter Code)
SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
Sequence
(Three-Letter Code)
H - Ser - Gln - Asp - Ser - Ala - Phe - Arg - Ile - Gln - Glu - Arg - Leu - Arg - Asn - Ser - Lys - Met - Ala - His - Ser - Ser - Ser - Cys - Phe - Gly - Gln - Lys - Ile - Asp - Arg - Ile - Gly - Ala - Val - Ser - Arg - Leu - Gly - Cys - Asp - Gly - Leu - Arg - Leu - Phe - OH (Disulfide bridge:23 - 39)
     
  < Back