Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Tau Peptides  >>  Tau Peptide (244-274) (Repeat 1 domain)

Product Name Tau Peptide (244 - 274) (Repeat 1 domain)  NEW
Ac - QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
Size 1 mg
Catalog # AS-65433-1
US$ $72
Purity Peak Area by HPLC ≥95%
Description

TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus (see figure below). Tau Peptide (244-274) is a 31-amino acid long peptide derived from the Repeat 1 domain.

RELATED PRODUCTS:

Tau Peptide (45-73) (Exon 2/Insert 1 domain)
Tau Peptide (74-102) (Exon 3/Insert 2 domain)
Tau Peptide (275-305) (Repeat 2 domain)
Tau Peptide (306-336) (Repeat 3 domain)
Tau Peptide (337-368) (Repeat 4 domain)


Images Tau Peptide (244-274) (Repeat 1 domain)
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Buee, L. et al. Brain Res Rev 33 95 (2000); Trinczek, B. et al. Mol Biol Cell 6, 1887 (1995).
Molecular Weight 3299.83
Sequence
(One-Letter Code)
Ac-QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
Sequence
(Three-Letter Code)
Ac - Gln - Thr - Ala - Pro - Val - Pro - Met - Pro - Asp - Leu - Lys - Asn - Val - Lys - Ser - Lys - Ile - Gly - Ser - Thr - Glu - Asn - Leu - Lys - His - Gln - Pro - Gly - Gly - Gly - Lys - OH
     
  < Back