Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  AggreSure β-Amyloid (1-40), human

Product Name AggreSure β - Amyloid (1 - 40), human  NEW
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.25 mg
Catalog # AS-72215
US$ $250
Purity >90%
Description

AggreSure beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using SensoLyte® ThT Aβ40 Aggregation kit (Cat# 72213). Aggregation is guaranteed.

Images AggreSure β-Amyloid (1-40), human
Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage –20°C
Molecular Weight 4329.9
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back