Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cell Permeable Peptides (CPP) / Drug Delivery Peptides  >>  Tat-Beclin-1, scrambled

Product Name Tat - Beclin - 1, scrambled  NEW
YGRKKRRQRRRGGVGNDFFINHETTGFATEW
Size 1 mg
Catalog # AS-65468
US$ $195
Purity % Peak Area By HPLC ≥ 95%
Description

Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. Tat-Beclin-1, scrambled will not induce autophagy and can be used as a negative control. RELATED PRODUCTS:Tat-Beclin-1, Cat# 65467Beclin-1, Cat# 65466

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
References Shoji-Kawata, S. Nature 494, 201-209 (2013); Marquez, RT. Am J Cancer Res 2 (2), 214221 (2012).
Molecular Weight 3741.1
Sequence
(One-Letter Code)
YGRKKRRQRRRGGVGNDFFINHETTGFATEW
Sequence
(Three-Letter Code)
Tyr - Gly - Arg - Lys - Lys - Arg - Arg - Gln - Arg - Arg - Arg - Gly - Gly - Val - Gly - Asn - His - Phe - Phe - Ile - Asn - His - Ser - Thr - Thr - Gly - Phe - Ala - Thr - Gln - Trp - OH
     
  < Back