Peptides  >  GPCR Peptide Ligands  >  GIPs
 Product Size Catalog # US$  
GIP (1 - 42), human
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
0.5 mg AS-61226-05 $198
GIP (1 - 42), human
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
1 mg AS-61226-1 $155
GIP (3 - 42), human
EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
1 mg AS-61227 $357
GIP, mouse, rat
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNITQ
0.5 mg AS-61228-05 $198
GIP, mouse, rat
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNITQ
1 mg AS-61228-1 $363
  < Back