Peptides  >  GPCR Peptide Ligands  >  PACAPs
 Product Size Catalog # US$  
Biotin - PACAP (1 - 38), amide, human, ovine, rat
Biotin - HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK - NH2
0.5 mg 23590 $291
PACAP (1 - 27), amide, human, ovine, rat
HSDGIFTDSYSRYRKQMAVKKYLAAVL - NH2
0.5 mg 22527 $132
PACAP (1 - 38), amide, human, ovine, rat
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK - NH2
0.5 mg 22519 $181
PACAP (1 - 38), amide, human, ovine, rat
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK - NH2
1 mg 22520 $313
PACAP (1 - 38) - Lys(Biotin), amide, human, ovine, rat
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin) - NH2
0.5 mg 23648 $401
PACAP (6 - 38), amide, human, ovine, rat
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK - NH2
0.5 mg 22516 $171
PACAP (6 - 38), amide, human, ovine, rat
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK - NH2
1 mg 22517 $303
  < Back