Peptides  >  GPCR Peptide Ligands  >  Apelin
 Product Size Catalog # US$  
[Ala13] - Apelin - 13
QRPRLSHKGPMPA
1 mg 61078 $93
[Pyr1] - Apelin - 13
Pyr - RPRLSHKGPMPF - OH
1 mg 60833 $77
Apelin 12
RPRLSHKGPMPF
1 mg 60836 $71
Apelin - 16, human, bovine
FRRQRPRLSHKGPMPF
1 mg 63699 $99
Apelin - 36, human
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
1 mg 61095 $319
  < Back