Peptides  >  GPCR Peptide Ligands  >  Neuropeptide
 Product Size Catalog # US$  
[D - Arg25] - Neuropeptide Y, human, rat
YPSKPDNPGEDAPAEDMARYYSALrHYINLITRQRY - NH2
YPSKPDNPGEDAPAEDMARYYSALrHYINLITRQRY - NH2
1 mg 24161 $181
[D - Trp34] - Neuropeptide Y, human
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRwRY - NH2
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRwRY - NH2
1 mg 24378 $291
[Leu31, Pro34] - Neuropeptide Y, human, rat
YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY - NH2
YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY - NH2
1 mg 24366 $181
Neuropeptide F
PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF - NH2
PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF - NH2
1 mg 60724 $341
Neuropeptide Y (3 - 36), human, rat
SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY - NH2
SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY - NH2
1 mg 22479 $215
Neuropeptide Y, free acid, human, rat
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
1 mg 22467 $181
Neuropeptide Y, human, rat
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY - NH2
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY - NH2
0.5 mg 22464 $121
Neuropeptide Y, human, rat
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY - NH2
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY - NH2
1 mg 22465 $181
  < Back