|
|
|
|
|
|
|
|
Agouti protein and Agouti-related protein (AGRP) are expressed in the adrenal glands and the hypothalamus and are high affinity antagonists of neural melanocortin-3 (MC3-R) and melanocortin-4 receptors (MC4-R). Agouti-related protein is a 132 amino-acid peptide homolog of skin agouti protein. Expression of Agouti protein is normally limited to the skin where it affects pigmentation, but ubiquitous expression causes obesity. Agouti-related protein is thought to play an important role in hypothalamic control of feeding behavior. Ubiquitous expression of Agouti which occurs in mice that carry the mutations in the agouti gene, gives rise to pleiotropic effects including the production of a yellow coat, obesity, insulin resistance, premature infertility. The Agouti gene codes for protein that regulates phaeomelanin synthesis in melanocytes. Genes important in embryonic development are also associated with this locus. The obesity syndrome appears to result specifically from blockade of MC4-R signaling.
Ref: Ollmann, M. Genes Dev. 12, 316 (1998); Ollmann, M. et al. Science 278, 135 (1997); Butler, AA. and RD. Cone, Neuropeptides 36, 77 (2002); Yang, Y. et al. Mol. Endocrinol. 13, 148 (1999); Shutter, J. Genes Dev. 11, 593 (1997); Haskell-Luevano, C. Endocrinol. 140, 1408 (1999). |
|
|
| Product |
Size |
Catalog # |
US$ |
|
AGRP (87 - 132), human Ac - CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNP CSRT |
0.1 mg |
27122 |
$457 |
 |
 |
AGRP fragment (83 - 132), amide SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMN PCSRT - NH2 (5 disulfide bridges) |
0.1 mg |
27124 |
$457 |
 |
 |
|
|
|
|
|