About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics
Peptides  >  Corticotropin Related Peptides
Corticotropin-releasing factor (CRF), a 41 amino acid-peptide widely distributed in the brain mediates endocrine as well as autonomic and behavioral responses to stress. Its receptor subtypes, CRF-R1 and CRF-R2, are expressed in the brain. CRF is hypersecreted from hypothalamic as well as from extrahypothalamic neurons in depression, resulting in hyperactivity of the hypothalamic-pituitary-adrenal (HPA) axis and elevations of cerebrospinal fluid concentrations of CRF. This increase in CRF neuronal activity is believed to mediate certain behavioral symptoms of depression involving sleep and appetite disturbances, reduced libido and psychomotor changes. The hyperactivity of CRF neuronal systems appears to be a state marker for depression because HPA axis hyperactivity normalizes following successful antidepressant treatment. The CRF system may play a significant role in the regulation of energy balance. CRF and CRF-related peptides, which elicit their effects through G-protein-coupled receptors known in mammals as CRF(1) receptor and CRF(2) receptor, are capable of strong anorectic and thermogenic effects. CRF, urocortin and urotensin I share amino acid sequences and they inhibit food intake in mammals.

Ref: Richard, D. et al. Eur. J. Pharmacol. 440, 89 (2002); Mitchell, A. Neurosci. Biobehav. Rev. 22, 635 (1998); Arborelius, L. et al. J. Endocrinol. 160, 1 (1999); Isogawa, K. et al. J. Psychopharmacol. 17, 409 (2003).
 Product Size Catalog # US$  
Biotin - Corticotropin Releasing Factor, Biotin - CRF, human, rat
Biotin - SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLM
EII - NH2
0.5 mg 23976 $303
Corticotropin Releasing Factor, CRF, human, rat
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII - NH2
0.5 mg 24253 $133
Corticotropin Releasing Factor, CRF, human, rat
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII - NH2
1 mg 24254 $190
Corticotropin Releasing Factor, CRF, ovine
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA - NH2
0.5 mg 22932 $159
  < Back