About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics
Peptides  >  Endorphin Peptides
Discovered in 1975, endorphins are neurotransmitters that reduce pain and anxiety, enhance the immune system and retard the aging process by removing superoxide. They have both neurological and spinal effects. At least 20 types of endorphins have been discovered in humans. a-endorphin contains 16 amino acids; b-endorphin, 31; g-endorphin, 17 and s-endorphin, 27. Endorphins are released by overexposure to light, in response to pain, stress, sexual activity and exercise. b-endorphin (END), the most effective endorphin, gives the most euphoric effect. b-endorphin as well as the mRNA for its precursor pro-opiomelanocortin are not only found in the pituitary gland but also within various types of immune cells infiltrating inflammed subcutaneous tissue. END is localized within secretory granules packed in membranous structures in macrophages, monocytes, granulocytes and lymphocytes. During stressful stimuli, END is released and interacts with peripheral opioid receptors to inhibit pain by blocking the signal of pain to the nervous system.

Ref: Mousa, SA. et al. Endocrinol. 145, 1331 (2004); Kauser, S. et al. J. Invest. Dermatol. 120, 1073 (2003); Low, M. et al. Ann. NY. Acad. Sci. 994, 192 (2003).
 Product Size Catalog # US$  
β - Endorphin, human
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
1 mg 24319 $99
β - Endorphin, porcine
YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
0.5 mg 20728 $93
Ac - β - Endorphin, human
Ac - YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
0.5 mg 24212 $99
Ac - β - Endorphin, human
Ac - YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
1 mg 20732 $159
  < Back