Peptides  >  Endothelins
Endothelins (ET) constitute a family of 21-amino acid peptides with potent biological activities. All have two disulfide bonds that hold them in a conical spiral shape. In addition to their vasoconstrictive properties, endothelins have inotropic and mitogenic properties. They influence salt and water balance, alter central and peripheral sympathetic activity and stimulate the renin-angiotensin-aldosterone system. ET is activated in hypertension, atherosclerosis, restenosis, heart failure, idiopathic cardiomyopathy and renal failure. Pre-pro-endothelin-1 is cleaved to the biologically inactive big endothelin-1 by the endothelin converting enzyme which further cleaves big endothelin to the active ET-1. ET-1 is the only family member produced by endothelial cells and in other types of cells such as neurons and astrocytes in the central nervous system, hepatocytes and Sertoli cells. It plays a significant role in the paracrine regulation of cardiovascular functions in humans. ET-2 and ET-3 are mainly produced in the kidney and intestine.

Ref: Palma, BD. et al. Brazilian J. Med. Biol. Res. 35, 75 (2002); Lüscher, T. Circulation 102, 2434 (2000); Suzaki, Y. et al. J. Cardiovasc. Pharmacol. 41, S83 (2003).
 Product Size Catalog # US$  
Big Endothelin 1 (1 - 39), porcine
CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1 - 15 and 3 - 11)
1 mg AS-20715 $583
Big Endothelin - 1 (1 - 38), human
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-62946-05 $363
Big Endothelin - 1 (1 - 38), human
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1 - 15 and 3 - 11)
1 mg AS-62946-1 $605
Endothelin 1, human, FAM - labeled
FAM - CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-27116 $605
Endothelin 1, human, HiLyte™ Fluor 488 - labeled
HiLyte™ Fluor 488 - CSCSSLMDKECVYFCHLDIIW (Disulfide Bridge: 1 - 15 and 3 - 11)
0.25 mg AS-64817-025 $413
Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.25 mg AS-22859 $181
Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-22860 $291
Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
1 mg AS-22861 $462
Endothelin 3, human, rat
CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
0.5 mg AS-24323 $193
Endothelin 3, human, rat
CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)
1 mg AS-24324 $341
  < Back