Endothelins

My Account

My Cart

My Custom Reports

My Favorites

Peptides > Endothelins

Endothelins (ET) constitute a family of 21-amino acid peptides with potent biological activities. All have two disulfide bonds that hold them in a conical spiral shape. In addition to their vasoconstrictive properties, endothelins have inotropic and mitogenic properties. They influence salt and water balance, alter central and peripheral sympathetic activity and stimulate the renin-angiotensin-aldosterone system. ET is activated in hypertension, atherosclerosis, restenosis, heart failure, idiopathic cardiomyopathy and renal failure. Pre-pro-endothelin-1 is cleaved to the biologically inactive big endothelin-1 by the endothelin converting enzyme which further cleaves big endothelin to the active ET-1. ET-1 is the only family member produced by endothelial cells and in other types of cells such as neurons and astrocytes in the central nervous system, hepatocytes and Sertoli cells. It plays a significant role in the paracrine regulation of cardiovascular functions in humans. ET-2 and ET-3 are mainly produced in the kidney and intestine.

Ref: Palma, BD. et al. Brazilian J. Med. Biol. Res. 35, 75 (2002); Lüscher, T. Circulation 102, 2434 (2000); Suzaki, Y. et al. J. Cardiovasc. Pharmacol. 41, S83 (2003).

Product	Size	Catalog #	US$
[Ala1,3,11,16] - Endothelin 1, human ASASSLMDKEAVYFAHLDIIW	0.5 mg	24321	$175
[Ala1,3,11,16] - Endothelin 1, human ASASSLMDKEAVYFAHLDIIW	1 mg	24322	$310
Big Endothelin 1 (1 - 39), porcine CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1 - 15 and 3 - 11)	0.25 mg	20713	$200
Big Endothelin 1 (1 - 39), porcine CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1 - 15 and 3 - 11)	0.5 mg	20714	$310
Big Endothelin 1 (1 - 39), porcine CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1 - 15 and 3 - 11)	1 mg	20715	$530
Big Endothelin - 1 (1 - 38), human CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1 - 15 and 3 - 11)	0.5 mg	62946-05	$330
Big Endothelin - 1 (1 - 38), human CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1 - 15 and 3 - 11)	1 mg	62946-1	$550
BQ123, Cyclo( - wdPvL - ), Endothelin Antagonist Cyclo( - wdPvL - )	1 mg	62357	$130
Endothelin 1, human, FAM - labeled FAM - CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)	0.5 mg	27116	$550
Endothelin 1, human, FAM - labeled FAM - CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)	1 mg	27117	$880
Endothelin 1, human, porcine CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)	0.25 mg	22859	$165
Endothelin 1, human, porcine CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)	0.5 mg	22860	$265
Endothelin 1, human, porcine CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)	1 mg	22861	$420
Endothelin 2, human CSCSSWLDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)	0.25 mg	22862	$165
Endothelin 2, human CSCSSWLDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)	0.5 mg	22863	$265
Endothelin 2, human CSCSSWLDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)	1 mg	22864	$420
Endothelin 2, human, FAM - labeled NEW FAM - CSCSSWLDKECVYFCHLDIIW (disulfide bridge: 1 - 15 and 3 - 11)	0.5 mg	64536-05	$500
Endothelin 2, human, FAM - labeled NEW FAM - CSCSSWLDKECVYFCHLDIIW (disulfide bridge: 1 - 15 and 3 - 11)	1 mg	64536-1	$800
Endothelin 3, human, rat CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)	0.5 mg	24323	$175
Endothelin 3, human, rat CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)	1 mg	24324	$310
Endothelin - 2, mouse CSCSNWLDKECVYFCHLDIIW (Disulfide bridge: 1 - 15 and 3 - 11)	0.5 mg	62356	$310
Orphanin FQ2, (OFQ2, NOCII) FSEFMRQYLVLSMQSSQ	1 mg	62609	$95

< Back