Galanins

Account Login

My Cart

My Custom Reports

My Favorites

Logout

Peptides > Galanins

Galanin (GAL) is a neuropeptide found in both the central and peripheral nervous systems. It is involved in normal growth and development of the nervous system and is critically important for the recovery of nerve function after nerve injury. In peripheral neurons, this peptide appears to be involved in influencing pain sensation after nerve injury (neuropathic pain). Following axonal injury, there is a dramatic rise in the levels of Galanin rnRNA and immunoreactivity in the neuronal cell bodies of sensory and autonomic ganglia. Lack of expression of Galanin or its inappropriate expression may lead to developmental problems or contribute to the devastating effects of dementia. Galanin also regulates appetite and controls hormone secretion from the brain. Receptor molecules mediate the effects of Galanin and researchers have identified and isolated at least three members of the Galanin receptor signaling family. In Alzheimer’s disease, GAL and GAL receptors are over-expressed in the limbic brain regions associated with cognition. Human Galanin consists of 30 amino acids, with a free carboxylic acid on the C-terminus, whereas all other known types of Galanin are composed of 29 amino acids with a C-terminus amide.

Ref: Tatemoto, K. et al. FEBS Lett. 164, 124 (1983); Wynick, D. et al. Curr. Opin. Pharmacol. 1, 73 (2001); Kalra, S. et al. Ann. NY. Acad. Sci. 863, 236 (1998); Tamas Bartfai, Neuropsychopharmacol. Edited by Kenneth L. Davis et al. American College of Neuropsychopharmacol. (2002); Crawley, JN. Life Sci. 58, 2185 (1996); Counts, SE. et al. Mol. Interventions 3, 137 (2003).

Product	Size	Catalog #	US$
Biotin - Galanin, human Biotin - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS	0.5 mg	23582	$181

Biotin - Galanin, human Biotin - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS	1 mg	23583	$303

Galanin (1 - 13) - Bradykinin (2 - 9), amide, M35 GWTLNSAGYLLGPPPGFSPFR - NH2	1 mg	22439	$165

Galanin (1 - 13) - Pro - Pro - (Ala - Leu)2 - Ala, amide GWTLNSAGYLLGPPPALALA - NH2	0.5 mg	22440	$121

Galanin (1 - 13) - Substance P (5 - 11), amide, Galantide GWTLNSAGYLLGPQQFFGLM - NH2	1 mg	22445	$165

Galanin Like Peptide (GALP) N - terminal fragment, porcine APVHRGRGGWTLNSAGYLLGPVLHPPSRAE	1 mg	61850-05	$143

Galanin Like Peptide, GALP (41 - 60), human, porcine, rat ILDLWKAIDGLPYSRSPRMT	1 mg	61848	$121

Galanin, human GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS	0.5 mg	22430	$137

Galanin, human GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS	1 mg	22431	$237

Galanin, human, FAM - labeled FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS	1 mg	23603	$423

Galanin, rat GWTLNSAGYLLGPHAIDNHRSFSDKHGLT - NH2	0.5 mg	22434	$154

Galanin, rat GWTLNSAGYLLGPHAIDNHRSFSDKHGLT - NH2	1 mg	22435	$275

Galanin - Lys(Biotin), human GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)	0.5 mg	23638	$253

Galanin - Lys(Biotin), human GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)	1 mg	23639	$423

Galanin - Lys(Biotin), human, FAM - labeled FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)	0.5 mg	23620	$253

Galanin - Lys(Biotin), human, FAM - labeled FAM - GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)	1 mg	23621	$423

< Back