Gastrins

Account Login

My Cart

My Custom Reports

My Favorites

Logout

Peptides > Gastrins

Gastrin is a hormone that is synthesized in the stomach as a result of the presence of food in the stomach. Synthesized as a preprohormone and post-translationally cleaved to form a family of peptides with identical carboxy terminals, gastrin is a major physiological regulator of gastric acid secretion and epithelial cell proliferation. It has an important trophic or growth-promoting influence on the gastric mucosa. It is one of the hormones that both integrates and controls digestive processes. Gastrin is competitively inhibited by cholecystokinin (CCK) and helps the pancreas and liver produce insulin. Over-secretion, especially in response to alcohol, and high levels of protein may lead to the formation of gastric ulcers, which may also increase gastrin release following Helicobacter pylori infection. Excessive secretion of gastrin, hypergastrinemia, may be the cause of a severe disease known as the Zollinger-Ellison syndrome. Gastrin may promote the development of cancers of the gastrointestinal tract.

Ref: Aly, A. et al. Biochem. Biophys. Acta. 1704, 1 (2004); Iwasaki, Y. et al. J. Gastroenterol. 39, 831 (2004).

Product	Size	Catalog #	US$
(Leu15) - Gastrin - 1, human Pyr - GPWLEEEEEAYGWLDF - NH2	1 mg	64149	$105

Big Gastrin - 1, human Pyr - LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF - NH2	0.5 mg	20747	$259

Biotin - Gastrin (1 - 17) Biotin - EGPWLEEEEEAYGWMDF - NH2	1 mg	60329-1	$143

Gastrin Releasing Peptide, human VPLPAGGGTVLTKMYPRGNHWAVGHLM - NH2	0.5 mg	24213	$115

Gastrin Releasing Peptide, human VPLPAGGGTVLTKMYPRGNHWAVGHLM - NH2	1 mg	24214	$193

Gastrin - 1, human Pyr - GPWLEEEEEAYGWMDF - NH2	1 mg	20750	$127

Gastrin - 1, rat Pyr - RPPMEEEEEAYGWMDF - NH2	1 mg	20752	$127

Leptin (93 - 105), human NVIQISNDLENLR	1 mg	62853	$83

Xenin MLTKFETKSARVKGLSFHPKRPWIL	0.5 mg	60753	$110

< Back