About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics
Peptides  >  Growth Hormone Related Peptides
Growth hormone (GH), or somatotropin, is a protein hormone of 191 amino acids that is produced in the anterior portion of the pituitary gland. Its release is controlled by the opposing actions of two hormones: growth hormone-releasing hormone, which stimulates both the synthesis and secretion of growth hormone; and somatostatin, which inhibits its release. GH plays a major role in the regulation of several complex physiologic processes in almost every organ and system in the body. It promotes growth in soft tissues, cartilage and bones; increases the synthesis of protein, RNA and DNA; decreases carbohydrate utilization and increases fat utilization. GH promotes bone growth by exerting a stimulating effect on the differentiation of proliferative chondrocytes or stem cell chondrocytes. A number of effects of GH is mediated by a insulin-like growth factor-1 (IGF-1) secreted from the liver and other tissues. Excessive production of growth hormone causes gigantism in youth and acromegaly in adults. Lack of the hormone in children results in dwarfism.

Ref: Englander, EW. et al. Mech. Ageing Dev. 125, 871 (2004); Sonntag, WE. et al. J. Anat. 197, 575 (2000); Lupu, F. et al. Dev. Biol. 229, 141 (2001); Lindahl, A. et al. Endocrinol. 118, 1843 (2004).
 Product Size Catalog # US$  
Growth Hormone Releasing Factor, GRF (1 - 29), amide, human
YADAIFTNSYRKVLGQLSARKLLQDIMSR - NH2
0.5 mg 22874 $77
Growth Hormone Releasing Factor, GRF (1 - 29), amide, human
YADAIFTNSYRKVLGQLSARKLLQDIMSR - NH2
1 mg 22875 $121
Growth Hormone Releasing Factor, GRF (1 - 44), amide, bovine
YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL -
NH2
1 mg 20772 $264
  < Back