|
|
|
Peptides > Growth Hormone Related Peptides
|
|
|
|
|
|
Growth hormone (GH), or somatotropin, is a protein hormone of 191 amino acids that is produced in the anterior portion of the pituitary gland. Its release is controlled by the opposing actions of two hormones: growth hormone-releasing hormone, which stimulates both the synthesis and secretion of growth hormone; and somatostatin, which inhibits its release. GH plays a major role in the regulation of several complex physiologic processes in almost every organ and system in the body. It promotes growth in soft tissues, cartilage and bones; increases the synthesis of protein, RNA and DNA; decreases carbohydrate utilization and increases fat utilization. GH promotes bone growth by exerting a stimulating effect on the differentiation of proliferative chondrocytes or stem cell chondrocytes. A number of effects of GH is mediated by a insulin-like growth factor-1 (IGF-1) secreted from the liver and other tissues. Excessive production of growth hormone causes gigantism in youth and acromegaly in adults. Lack of the hormone in children results in dwarfism.
Ref: Englander, EW. et al. Mech. Ageing Dev. 125, 871 (2004); Sonntag, WE. et al. J. Anat. 197, 575 (2000); Lupu, F. et al. Dev. Biol. 229, 141 (2001); Lindahl, A. et al. Endocrinol. 118, 1843 (2004). |
|
|
| Product |
Size |
Catalog # |
US$ |
|
Growth Hormone Releasing Factor, GRF (1 - 29), amide, human YADAIFTNSYRKVLGQLSARKLLQDIMSR - NH2 |
0.5 mg |
22874 |
$77 |
 |
 |
Growth Hormone Releasing Factor, GRF (1 - 29), amide, human YADAIFTNSYRKVLGQLSARKLLQDIMSR - NH2 |
1 mg |
22875 |
$121 |
 |
 |
Growth Hormone Releasing Factor, GRF (1 - 44), amide, bovine YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL - NH2 |
1 mg |
20772 |
$264 |
 |
 |
|
|
|
|
|