Peptides  >  Matrix Metalloproteinases (MMPs)
Matrix metalloproteinases (MMPs) are a family of highly homologous protein-degrading zinc dependent enzymes endopeptidases.This family currently includes more than 25 members that can be divided into collagenases (MMP-1, -8, and -13), gelatinases (MMP-2 and 9), stromelysins (MMP-3 and 10), matrilysins (MMP-7 and 26), and the membrane-type MMPs (MMP-14 to 17 and 24). MMPs are important in many normal biological processes including embryonic development, angiogenesis, and wound healing, as well as in pathological processes such as inflammation, cancer, and tissue destruction. MMPs collectively cleave most, if not all, of the constituents of the extracellular matrix (ECM) and are involved in the breakdown and remodeling of many tissues and organs.

Ref: Birkedal-Hansen, H. et al. Crit. Rev. Oral Biol. Med. 4, 197 (1993 ); Lenhart, J. et al. Endocrinol. 142, 3941 (2001); Gabison, EE. et al. Am. J. Pathol. 166, 209 (2005); Isaksen, B. and MK. Fagerhol, J. Clin. Pathol. Mol. Pathol. 54, 289 (2001).
 Product Size Catalog # US$  
360 MMP FRET Substrate I
Dnp - PLGLWAr - NH2
Dnp - PLGLWAr - NH2
1 mg 27074 $99
360 MMP FRET Substrate I
Dnp - PLGLWAr - NH2
Dnp - PLGLWAr - NH2
5 mg 27075 $341
360 MMP FRET Substrate II
[DNP - Pro - Leu - Ala - Leu - Trp - Ala - Arg - OH]
1 mg 27082 $71
360 MMP FRET Substrate II
Dnp - PLALWAR
Dnp - PLALWAR
5 mg 27083 $291
360 MMP FRET Substrate III
Dnp - PLGMWSR
Dnp - PLGMWSR
1 mg 27094 $71
360 MMP FRET Substrate IV
Dnp - PYAYWMR
Dnp - PYAYWMR
1 mg 27098 $71
360 MMP FRET Substrate IV
Dnp - PYAYWMR
Dnp - PYAYWMR
5 mg 27099 $291
360 MMP FRET Substrate V
Dnp - RPLALWRS
Dnp - RPLALWRS
1 mg 27102 $71
360 MMP FRET Substrate VI
Dnp - PLAYWAR
Dnp - PLAYWAR
1 mg 27106 $71
360 MMP FRET Substrate VI
Dnp - PLAYWAR
Dnp - PLAYWAR
5 mg 27107 $291
390 MMP FRET Substrate I
Mca - PLGL - Dpa - AR - NH2
Mca - PLGL - Dap(Dnp) - AR - NH2
1 mg 27076 $99
390 MMP FRET Substrate I
Mca - PLGL - Dpa - AR - NH2
Mca - PLGL - Dap(Dnp) - AR - NH2
5 mg 27077 $396
390 MMP FRET Substrate II
Mca - PLGL - Dpa - AR
Mca - PLGL - Dap(Dnp) - AR
5 mg 27079 $385
390 MMP FRET Substrate III
Mca - PLA - Nva - Dpa - AR - NH2
Mca - PLA - Nva - Dap(Dnp) - AR - NH2
1 mg 27090 $99
390 MMP FRET Substrate IV
Mca - P - Cha - G - Nva - HA - Dpa - NH2
Mca - P - Cha - G - Nva - HA - Dap(Dnp) - NH2
1 mg 27108 $99
390 MMP FRET Substrate IV
Mca - P - Cha - G - Nva - HA - Dpa - NH2
Mca - P - Cha - G - Nva - HA - Dap(Dnp) - NH2
5 mg 27109 $385
390 MMP FRET Substrate V
Mca - PLGLEEA - Dpa - NH2
Mca - PLGLEEA - Dap(Dnp) - NH2
1 mg 62027 $83
490 MMP FRET Substrate III
DABCYL - RPLALWRS - EDANS
DABCYL - RPLALWRS - EDANS
1 mg 27104 $220
490 MMP FRET Substrate IV
DabcylPlus - KPLA - Nva - D(EDANS) - AR - NH2
DabcylPlus - KPLA - Nva - D(EDANS) - AR - NH2
0.1 mg 60637 $93
490 MMP FRET Substrate V
NBD - RPKPLA - Nva - WK(DMC) - NH2
NBD - RPKPLA - Nva - WK(DMC) - NH2
1 mg 60563-1 $363
5 - FAM MMP FRET Peptide Fluorescence Standard I
5 - FAM - PL
5 - FAM - PL
0.1 mg 60584-01 $115
520 MMP FRET Substrate I
QXL 520 - PLGLWArK(5 - FAM) - NH2
QXL 520 - PLGLWArK(5 - FAM) - NH2
0.1 mg 60568-01 $159
520 MMP FRET Substrate II
QXL 520 - PLALWARK(5 - FAM) - NH2
QXL 520 - PLALWARK(5 - FAM) - NH2
0.1 mg 60569-01 $159
520 MMP FRET Substrate III
QXL 520 - PLGC(Me)HAr - K(5 - FAM) - NH2
QXL 520 - PLGC(Me)HAr - K(5 - FAM) - NH2
0.1 mg 60570-01 $159
520 MMP FRET Substrate IV
5 - FAM - PLA - Nva - Dap(QXL 520) - AR - NH2
5 - FAM - PLA - Nva - Dap(QXL 520) - AR - NH2
0.1 mg 60571-01 $159
520 MMP FRET Substrate IX
QXL 520 - RPLALWRK(5 - FAM) - NH2
QXL 520 - RPLALWRK(5 - FAM) - NH2
0.1 mg 60576-01 $159
520 MMP FRET Substrate V
5 - FAM - PLGL - Dap(QXL 520) - AR - NH2
5 - FAM - PLGL - Dap(QXL 520) - AR - NH2
0.1 mg 60572-01 $159
520 MMP FRET Substrate VI
QXL 520 - PLGMWSRK(5 - FAM) - NH2
QXL 520 - PLGMWSRK(5 - FAM) - NH2
0.1 mg 60573-01 $159
520 MMP FRET Substrate VII
QXL 520 - PYAYWMRK(5 - FAM) - NH2
QXL 520 - PYAYWMRK(5 - FAM) - NH2
0.1 mg 60574-01 $159
520 MMP FRET Substrate VIII
QXL 520 - RPKPLA - Nva - WK(5 - FAM) - NH2
QXL 520 - RPKPLA - Nva - WK(5 - FAM) - NH2
0.1 mg 60575-01 $159
520 MMP FRET Substrate X
QXL 520 - PLAYWARK(5 - FAM) - NH2
QXL 520 - PLAYWARK(5 - FAM) - NH2
0.1 mg 60577-01 $159
520 MMP FRET Substrate XI
5 - FAM - P - Cha - G - Nva - HA - Dap(QXL 520) - NH2
5 - FAM - P - Cha - G - Nva - HA - Dap(QXL 520) - NH2
0.1 mg 60578-01 $159
520 MMP FRET Substrate XII
5 - FAM - RPKPYA - Nva - WM - K(QXL 520) - NH2
5 - FAM - RPKPYA - Nva - WM - K(QXL 520) - NH2
0.1 mg 60579-01 $159
520 MMP FRET Substrate XIII
5 - FAM - RPKPVE - Nva - WRK(QXL 520) - NH2
5 - FAM - RPKPVE - Nva - WRK(QXL 520) - NH2
0.1 mg 60580-01 $159
520 MMP FRET Substrate XIV
QXL 520 - γ - Abu - P - Cha - Abu - Smc - HA - Dab(5 - FAM) - AK - NH2 (Smc=S - Methyl - L - cysteine)
QXL 520 - γ - Abu - P - Cha - Abu - Smc - HA - Dab(5 - FAM) - AK - NH2 (Smc=S - Methyl - L - cysteine)
0.1 mg 60581-01 $159
520 MMP FRET Substrate XV
QXL 520 - γ - Abu - PQGL - Dab(5 - FAM) - AK - NH2
QXL 520 - γ - Abu - PQGL - Dab(5 - FAM) - AK - NH2
0.1 mg 60582-01 $159
520 MMP FRET Substrate XVI
QXL 520 - RPKPQQFWK(5 - FAM) - NH2
QXL 520 - RPKPQQFWK(5 - FAM) - NH2
0.1 mg 60583-01 $159
520 MMP FRET Substrate XVII
QXL 520 - KPLA - Nva - Dap(5 - FAM) - AR - NH2
QXL 520 - KPLA - Nva - Dap(5 - FAM) - AR - NH2
0.1 mg 60554-01 $159
520 MMP FRET Substrate XVII, scrambled
QXL 520 - Nva - LPKA - Dap(5 - FAM) - AR - NH2
QXL520 - Nva - LPKA - Dap(5 - FAM) - AR - NH2
0.1 mg 64456-01 $159
580 MMP FRET Substrate I
QXL 570 - KPLA - Nva - Dap(5 - TAMRA) - AR - NH2
QXL 570 - KPLA - Nva - Dap(5 - TAMRA) - AR - NH2
0.1 mg 60585-01 $159
CTT, Gelatinase Inhibitor
CTTHWGFTLC (Disulfide Bridge: 1 - 10)
CTTHWGFTLC (Disulfide Bridge: 1 - 10)
1 mg 62054 $115
FRETS - VWF73 (Fluorescence - Quenching Substrate for ADAMTS - 13)
DRE - Dap(Nma) - APNLVYMVTG - Dpa - PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
DRE - Dap(Nma) - APNLVYMVTG - Dap(Dnp) - PASDEIKRLPGD
IQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQ
R
0.1 mg 63728-01 $303
FRETS - VWF73 (Fluorescence - Quenching Substrate for ADAMTS - 13)
DRE - Dap(Nma) - APNLVYMVTG - Dpa - PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
DRE - Dap(Nma) - APNLVYMVTG - Dap(Dnp) - PASDEIKRLPGD
IQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQ
R
0.5 mg 63728-05 $1149
Mca MMP FRET Peptide Fluorescence Standard I
Mca - PL
Mca - PL
1 mg 27159 $39
Mca MMP FRET Peptide Fluorescence Standard II
Mca - RPKPQ
Mca - RPKPQ
1 mg 27112 $61
Mca MMP FRET Peptide Fluorescence Standard II
Mca - RPKPQ
Mca - RPKPQ
5 mg 27113 $242
MMP Colorimetric Substrate I
Ac - PLG - SCH[CH2CH(CH3)2] - CO - LG - OC2H5
Ac - PLG - SCH[CH2CH(CH3)2] - CO - LG - OC2H5
1 mg 27096 $121
MMP Colorimetric Substrate I
Ac - PLG - SCH[CH2CH(CH3)2] - CO - LG - OC2H5
Ac - PLG - SCH[CH2CH(CH3)2] - CO - LG - OC2H5
5 mg 27097 $484
MMP Peptide Inhibitor I
Ac - RCGVPD - NH2
Ac - RCGVPD - NH2
1 mg 27157 $49
MMP Peptide Inhibitor I
Ac - RCGVPD - NH2
Ac - RCGVPD - NH2
5 mg 27158 $193
NFF - 2
Mca - RPKPYA - Nva - WM - K(Dnp) - NH2
Mca - RPKPYA - Nva - WM - K(Dnp) - NH2
5 mg 27111 $385
NFF - 3
Mca - RPKPVE - Nva - WR - K(Dnp) - NH2
Mca - RPKPVE - Nva - WR - K(Dnp) - NH2
1 mg 27114 $99
NFF - 3
Mca - RPKPVE - Nva - WR - K(Dnp) - NH2
Mca - RPKPVE - Nva - WR - K(Dnp) - NH2
5 mg 27115 $385
TNO113
DABCYL - (γ - Abu) - P - Cha - Abu - Smc - HA - E(EDANS) - AK - NH2 (Smc=S - Methyl - L - Cysteine)
DABCYL - (γ - Abu) - P - Cha - Abu - Smc - HA - E(EDANS)
- AK - NH2 (Smc=S - Methyl - L - Cysteine)
1 mg 27061 $291
TNO211
DABCYL - (γ - Abu) - PQGL - E(EDANS)AK - NH2
DABCYL - (γ - Abu) - PQGL - E(EDANS)AK - NH2
1 mg 25350 $253
TNO211
DABCYL - (γ - Abu) - PQGL - E(EDANS)AK - NH2
DABCYL - (γ - Abu) - PQGL - E(EDANS)AK - NH2
5 mg 25350-5 $1017
WAAG - 3R, Aggrecanase (ADAM - TS - 4) FRET Substrate
Abz - TEGEARGSVI - Dpa - KK - NH2
Abz - TEGEARGSVI - Dap(Dnp) - KK - NH2
1 mg 60431-1 $237
  < Back