Peptides  >  Matrix Metalloproteinases (MMPs)
Matrix metalloproteinases (MMPs) are a family of highly homologous protein-degrading zinc dependent enzymes endopeptidases.This family currently includes more than 25 members that can be divided into collagenases (MMP-1, -8, and -13), gelatinases (MMP-2 and 9), stromelysins (MMP-3 and 10), matrilysins (MMP-7 and 26), and the membrane-type MMPs (MMP-14 to 17 and 24). MMPs are important in many normal biological processes including embryonic development, angiogenesis, and wound healing, as well as in pathological processes such as inflammation, cancer, and tissue destruction. MMPs collectively cleave most, if not all, of the constituents of the extracellular matrix (ECM) and are involved in the breakdown and remodeling of many tissues and organs.

Ref: Birkedal-Hansen, H. et al. Crit. Rev. Oral Biol. Med. 4, 197 (1993 ); Lenhart, J. et al. Endocrinol. 142, 3941 (2001); Gabison, EE. et al. Am. J. Pathol. 166, 209 (2005); Isaksen, B. and MK. Fagerhol, J. Clin. Pathol. Mol. Pathol. 54, 289 (2001).
 Product Size Catalog # US$  
360 MMP FRET Substrate I
Dnp - PLGLWAr - NH2
1 mg AS-27074 $99
360 MMP FRET Substrate I
Dnp - PLGLWAr - NH2
5 mg AS-27075 $341
360 MMP FRET Substrate II
[DNP - Pro - Leu - Ala - Leu - Trp - Ala - Arg - OH]
1 mg AS-27082 $71
360 MMP FRET Substrate II
Dnp - PLALWAR
5 mg AS-27083 $291
360 MMP FRET Substrate III
Dnp - PLGMWSR
1 mg AS-27094 $71
360 MMP FRET Substrate IV
Dnp - PYAYWMR
1 mg AS-27098 $71
360 MMP FRET Substrate IV
Dnp - PYAYWMR
5 mg AS-27099 $291
360 MMP FRET Substrate V
Dnp - RPLALWRS
1 mg AS-27102 $71
360 MMP FRET Substrate VI
Dnp - PLAYWAR
1 mg AS-27106 $71
360 MMP FRET Substrate VI
Dnp - PLAYWAR
5 mg AS-27107 $291
390 MMP FRET Substrate I
Mca - PLGL - Dpa - AR - NH2
1 mg AS-27076 $99
390 MMP FRET Substrate I
Mca - PLGL - Dpa - AR - NH2
5 mg AS-27077 $396
390 MMP FRET Substrate II
Mca - PLGL - Dpa - AR
5 mg AS-27079 $385
390 MMP FRET Substrate III
Mca - PLA - Nva - Dpa - AR - NH2
1 mg AS-27090 $99
390 MMP FRET Substrate IV
Mca - P - Cha - G - Nva - HA - Dpa - NH2
1 mg AS-27108 $99
390 MMP FRET Substrate IV
Mca - P - Cha - G - Nva - HA - Dpa - NH2
5 mg AS-27109 $385
390 MMP FRET Substrate V
Mca - PLGLEEA - Dpa - NH2
1 mg AS-62027 $83
490 MMP FRET Substrate III
DABCYL - RPLALWRS - EDANS
1 mg AS-27104 $220
490 MMP FRET Substrate IV
DabcylPlus - KPLA - Nva - D(EDANS) - AR - NH2
0.1 mg AS-60637 $93
490 MMP FRET Substrate V
NBD - RPKPLA - Nva - WK(DMC) - NH2
1 mg AS-60563-1 $363
5 - FAM MMP FRET Peptide Fluorescence Standard I
5 - FAM - PL
0.1 mg AS-60584-01 $115
520 MMP FRET Substrate I
QXL 520 - PLGLWArK(5 - FAM) - NH2
0.1 mg AS-60568-01 $159
520 MMP FRET Substrate II
QXL 520 - PLALWARK(5 - FAM) - NH2
0.1 mg AS-60569-01 $159
520 MMP FRET Substrate III
QXL 520 - PLGC(Me)HAr - K(5 - FAM) - NH2
0.1 mg AS-60570-01 $159
520 MMP FRET Substrate IV
5 - FAM - PLA - Nva - Dap(QXL 520) - AR - NH2
0.1 mg AS-60571-01 $159
520 MMP FRET Substrate IX
QXL 520 - RPLALWRK(5 - FAM) - NH2
0.1 mg AS-60576-01 $159
520 MMP FRET Substrate V
5 - FAM - PLGL - Dap(QXL 520) - AR - NH2
0.1 mg AS-60572-01 $159
520 MMP FRET Substrate VI
QXL 520 - PLGMWSRK(5 - FAM) - NH2
0.1 mg AS-60573-01 $159
520 MMP FRET Substrate VII
QXL 520 - PYAYWMRK(5 - FAM) - NH2
0.1 mg AS-60574-01 $159
520 MMP FRET Substrate VIII
QXL 520 - RPKPLA - Nva - WK(5 - FAM) - NH2
0.1 mg AS-60575-01 $159
520 MMP FRET Substrate X
QXL 520 - PLAYWARK(5 - FAM) - NH2
0.1 mg AS-60577-01 $159
520 MMP FRET Substrate XI
5 - FAM - P - Cha - G - Nva - HA - Dap(QXL 520) - NH2
0.1 mg AS-60578-01 $159
520 MMP FRET Substrate XII
5 - FAM - RPKPYA - Nva - WM - K(QXL 520) - NH2
0.1 mg AS-60579-01 $159
520 MMP FRET Substrate XIII
5 - FAM - RPKPVE - Nva - WRK(QXL 520) - NH2
0.1 mg AS-60580-01 $159
520 MMP FRET Substrate XIV
QXL 520 - γ - Abu - P - Cha - Abu - Smc - HA - Dab(5 - FAM) - AK - NH2 (Smc=S - Methyl - L - cysteine)
0.1 mg AS-60581-01 $159
520 MMP FRET Substrate XV
QXL 520 - γ - Abu - PQGL - Dab(5 - FAM) - AK - NH2
0.1 mg AS-60582-01 $159
520 MMP FRET Substrate XVI
QXL 520 - RPKPQQFWK(5 - FAM) - NH2
0.1 mg AS-60583-01 $159
520 MMP FRET Substrate XVII
QXL 520 - KPLA - Nva - Dap(5 - FAM) - AR - NH2
0.1 mg AS-60554-01 $159
520 MMP FRET Substrate XVII, scrambled
QXL 520 - Nva - LPKA - Dap(5 - FAM) - AR - NH2
0.1 mg AS-64456-01 $159
580 MMP FRET Substrate I
QXL 570 - KPLA - Nva - Dap(5 - TAMRA) - AR - NH2
0.1 mg AS-60585-01 $159
CTT, Gelatinase Inhibitor
CTTHWGFTLC (Disulfide Bridge: 1 - 10)
1 mg AS-62054 $115
FRETS - VWF73 (Fluorescence - Quenching Substrate for ADAMTS - 13)
DRE - Dap(Nma) - APNLVYMVTG - Dpa - PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
0.1 mg AS-63728-01 $303
FRETS - VWF73 (Fluorescence - Quenching Substrate for ADAMTS - 13)
DRE - Dap(Nma) - APNLVYMVTG - Dpa - PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
0.5 mg AS-63728-05 $1149
Mca MMP FRET Peptide Fluorescence Standard I
Mca - PL
1 mg AS-27159 $39
Mca MMP FRET Peptide Fluorescence Standard II
Mca - RPKPQ
1 mg AS-27112 $61
Mca MMP FRET Peptide Fluorescence Standard II
Mca - RPKPQ
5 mg AS-27113 $242
MMP Colorimetric Substrate I
Ac - PLG - SCH[CH2CH(CH3)2] - CO - LG - OC2H5
1 mg AS-27096 $121
MMP Colorimetric Substrate I
Ac - PLG - SCH[CH2CH(CH3)2] - CO - LG - OC2H5
5 mg AS-27097 $484
NFF - 2
Mca - RPKPYA - Nva - WM - K(Dnp) - NH2
5 mg AS-27111 $385
NFF - 3
Mca - RPKPVE - Nva - WR - K(Dnp) - NH2
1 mg AS-27114 $99
NFF - 3
Mca - RPKPVE - Nva - WR - K(Dnp) - NH2
5 mg AS-27115 $385
TNO113
DABCYL - (γ - Abu) - P - Cha - Abu - Smc - HA - E(EDANS) - AK - NH2 (Smc=S - Methyl - L - Cysteine)
1 mg AS-27061 $291
TNO211
DABCYL - (γ - Abu) - PQGL - E(EDANS)AK - NH2
1 mg AS-25350 $253
TNO211
DABCYL - (γ - Abu) - PQGL - E(EDANS)AK - NH2
5 mg AS-25350-5 $1017
WAAG - 3R, Aggrecanase (ADAM - TS - 4) FRET Substrate
Abz - TEGEARGSVI - Dpa - KK - NH2
1 mg AS-60431-1 $237
  < Back