Natriuretic Peptides

Account Login

My Cart

My Custom Reports

My Favorites

Logout

Peptides > Natriuretic Peptides

Natriuretic peptides are a family of naturally occurring proteins that play a major role in down-regulating the activity of the renin-angiotensin-aldosterone system; regulating circulatory homeostasis; modulating cardiovascular system, causing natriuresis and vasodilatation. There are at least three major natriuretic peptides that have been discovered: atrial natriuretic peptide (ANP)- secreted largely by the atria; brain natriuretic peptide (BNP) - produced by the ventricles and C-type natriuretic peptide (CNP)- located in peripheral blood vessels.

Ref: De Bold , A. et al. Life Sci. 28, 89 (1981); Maeda, K. et al. Am. Heart J. 135, 825 (1998); Cardarelli, R. et al. J. Am. Board Fam. Prac. 16, 327 (2003); Struthers, A. BMJ 308, 1615 (1994); Levin, E. et al. N. Engl. J. Med. 339, 321 (1998); Cheung, B. et al. JAMA 280, 1983 (1998); Kalra, P. et al. Eur. Heart J. 22, 997 (2001); Ee Lemos, JA. et al. Lancet 362, 316 (2005).

Product	Size	Catalog #	US$
Atrial Natriuretic Peptide (1 - 28), human, porcine SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)	0.5 mg	20647	$121

Atrial Natriuretic Peptide (1 - 28), human, porcine SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)	1 mg	20648	$145

Atrial Natriuretic Peptide (1 - 28), human, porcine, Biotin - labeled Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)	0.5 mg	23972	$181

Atrial Natriuretic Peptide (1 - 28), human, porcine, Biotin - labeled Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)	1 mg	23973	$303

Atrial Natriuretic Peptide (1 - 28), rat SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)	0.5 mg	20651	$121

Atrial Natriuretic Peptide (1 - 28), rat SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)	1 mg	20652	$150

Atrial Natriuretic Peptide (4 - 18), rat RSSCFGGRIDRIGAC - NH₂ (Disulfide bridge 4 - 15)	1 mg	62839	$143

BNP (64 - 95), rat NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10 - 26)	1 mg	22931	$385

BNP - 32, human SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10 - 26)	0.5 mg	24015	$242

BNP - 32, human SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10 - 26)	1 mg	24016	$385

BNP - 45 (51 - 95), rat, 5K Cardiac Natriuretic Peptide SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)	0.5 mg	61153	$303

BNP - 45, mouse SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL (Disulfide bridge:23 - 39)	0.5 mg	61152	$303

C - Type Natriuretic Peptide (32 - 53), human, porcine GLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: 6 - 22)	1 mg	24244	$220

Thr - Ala - Pro - Arg - Atrial Natriuretic Peptide, Urodilatin, human TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 11 - 27)	1 mg	20650	$264

< Back