About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics
Peptides  >  Peptide YY and Analogs
Peptide Tyrosine Tyrosine (PYY), Neuropeptide Y (NPY) and Pancreatic Polypeptide (PP) are anorectic gut hormones belonging to the PP fold peptide family. PYY shares over 70% sequence identity with NPY and is a 36-amino acid regulatory gut hormone present in endocrine cells of the intestine. Specific PYY receptors have been reported in brain tissue, spleen, vascular smooth muscle, neuroendocrine cell lines, chief cells, and mucosa of the small and large intestine. Full-length PYY binds with high affinity to all Y receptors. PYY acts both as an endocrine and a paracrine agent. It is secreted from intestinal L-cells in response to dietary carbohydrate and fat. The biological action of this peptide includes inhibition of gut motility and gastrointestinal and pancreatic secretions. It also acts as a vasoconstrictor. These effects are thought to be mediated both directly in the periphery and centrally via the area postrema and the nucleus of the solitary tract. The majority of PYY found in the cells and present in the circulation is in the PYY(3-36) form. This Y2R agonist is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal. Like adipocyte hormone leptin, PYY reduces food intake by modulating appetite circuits in the hypothalamus. PYY deficiency may contribute to the pathogenesis of obesity.

Ref: Halldén, G. and G. Aponte, J. Biol. Chem. 272 12591 (1997); Murphy, KG. and SR. Bloom, Exp. Physiol. 89, 507 (2004); Batterham, R. et al. Nature 418, 650 (2002); Gribble, F. et al. Diabetes 52,1147 (2003); Batterham, R. et al. N. Engl. J. Med. 349, 941 (2003).
 Product Size Catalog # US$  
Peptide YY (3 - 36), human
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY - NH2
0.5 mg 24405 $143
Peptide YY (3 - 36), human
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY - NH2
1 mg 24406 $253
Peptide YY, human
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY - NH2
0.5 mg 24401 $143
Peptide YY, human
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY - NH2
1 mg 24402 $253
  < Back