About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics
Peptides  >  Prolactin Releasing Peptides
Prolactin is involved in the development of the mammary glands and the promotion of milk synthesis in mammals. Prolactin-releasing peptide (PrRP), expressed specifically in the human pituitary is identified in the hypothalamus as a potent prolactin-releasing factor for anterior pituitary cells. This peptide may play a role in the control of food intake, stress response and nociception. PrRP is a member of the RFamide peptide family and is an endogenous ligand for the orphan G protein-coupled receptor (GPCR), hGR3.

Ref: Hinuma S. et al. Nature(Lond) 393, 272 (1998); Engstrom, M. et al. J. Pharmacol. Exp. Ther. 305, 825 (2003); Kimura, A. et al. J. Biol. Chem. 275, 3667 (2000); Chartrel, N. et al. Proc. Natl. Acad. Sci. USA 100, 15247 (2003).
 Product Size Catalog # US$  
Prolactin Releasing Peptide (1 - 31), human
SRTHRHSMEIRTPDINPAWYASRGIRPVGRF - NH2
0.5 mg 28215 $242
Prolactin Releasing Peptide (1 - 31), rat
SRAHQHSMETRTPDINPAWYTGRGIRPVGRF - NH2
0.5 mg 28217 $242
  < Back