Peptides  >  OVA Peptides
 Product Size Catalog # US$  
OVA (241 - 270)
SMLVLLPDEVSGLEQLESIINFEKLTEWTS
1 mg AS-64525 $209
OVA (257 - 264)
SIINFEKL
1 mg AS-60193-1 $49
OVA (257 - 264)
SIINFEKL
5 mg AS-60193-5 $198
OVA (257 - 264), amide
SIINFEKL - NH2
5 mg AS-62572-5 $313
OVA (257 - 264), FAM labeled
5 - FAM - SIINFEKL - NH2
1 mg AS-64231 $225
OVA (257 - 264), scrambled, FILKSINE
FILKSINE
1 mg AS-64413 $99
OVA (323 - 339)
ISQAVHAAHAEINEAGR
1 mg AS-27024 $110
OVA (323 - 339)
ISQAVHAAHAEINEAGR
5 mg AS-27025 $435
OVA (323 - 339), amide
ISQAVHAAHAEINEAGR - NH2
5 mg AS-62571-5 $396
OVA (323 - 339), amide
ISQAVHAAHAEINEAGR - NH2
1 mg AS-62571-1 $99
OVA (323 - 339), biotin - labeled
Biotin - ISQAVHAAHAEINEAGR
1 mg AS-64767 $165
OVA (323 - 339), FITC - labeled
FITC - LC - ISQAVHAAHAEINEAGR
1 mg AS-64766 $247
OVA (323 - 339), TAMRA labeled
5 - TAMRA - ISQAVHAAHAEINEAGR
1 mg AS-64232 $275
OVA (329 - 337)
AAHAEINEA
1 mg AS-64777 $77
OVA (55 - 62), KVVRFDKL
KVVRFDKL
1 mg AS-64412 $99
OVA - A2 Peptide, SAINFEKL, OVA (257 - 264) Variant
SAINFEKL
1 mg AS-64383 $99
OVA - G4 Peptide, SIIGFEKL, OVA (257 - 264) Variant
SIIGFEKL
1 mg AS-64384 $99
OVA - Q4 Peptide, pQ4, SIIQFEKL, OVA (257 - 264) Variant  
SIIQFEKL
1 mg AS-64402 $99
OVA - Q4H7 Peptide, pQ4H7, SIIQFEHL, OVA (257 - 264) Variant  
SIIQFEHL
1 mg AS-64405 $99
OVA - T4 Peptide, SIITFEKL, pT4, OVA (257 - 264) Variant  
SIITFEKL
1 mg AS-64403 $99
  < Back