Adrenomedullin Peptides

Account Login

My Cart

My Custom Reports

My Favorites

Logout

Peptides > Adrenomedullin Peptides

Adrenomedullin (AM) is a 52 amino acid vasoactive peptide discovered in 1993. A member of the calcitonin family of peptides, it shares sequence homology with the calcitonin gene-related peptide (CGRP) and peptides from the pancreatic amylin family. cDNA sequences of rat, pig and human reveal that preproadrenomedullin consists of 185 amino acids, with 3 sites of paired basic amino acids as targets for prohormone-processing proteolytic cleavage. AM is produced by several tissues, including adrenal medulla, lung, kidney, retinal pigment epithelium, neurons, astrocytes, vascular endothelium, vascular smooth muscle cells and heart. It plays an important role in physiological regulation of circulation, having a potent hypotensive effect when infused into circulation. It increases cardiac contractility, dilates coronary arteries and modulates stretch-

Product	Size	Catalog #	US$
Adrenomedullin (1 - 50), rat YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKI SPQGY - NH2 (Disulfide bridge: 14 - 19)	0.5 mg	60454	$335

Adrenomedullin (1 - 52), human YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRS KISPQGY - NH2 (Disulfide bridge: 16 - 21)	0.5 mg	60447	$335

Adrenomedullin (22 - 52), human TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY - NH2	0.5 mg	60449	$181

< Back