|
|
|
|
|
|
|
|
Apelin, a peptide first isolated from bovine stomach tissue extracts, is the endogenous ligand of the human G protein-coupled orphan APJ receptor. The ligand was named ”apelin” after APJ endogenous ligand. The two major isoforms are apelin-13 and apelin 36. Apelin and APJ are widely expressed in homogenates from animal organs in a pattern shared with angiotensinogen and the angiotensin receptor. Apelin is widely distributed in the CNS and periphery, especially in the heart, kidney, lung and mammary glands. Apelin-like immunoreactivity was detected in the adipocytes, gastric mucosa, endothelia and Kupffer cells in the liver. Apelin is a neuropeptide involved in the regulation of body fluid homeostasis and cardiovascular functions. It reduces blood pressure via a nitric oxide–dependent, possibly central mechanism, exerting a stronger positive inotropic effect on a molar basis (EC50 33 pmol/L) than any agent yet described.
Ref: Hosoya, M. et al. J. Biol. Chem. 275, 21061 (2000); Reaux, A. et al. J. Neurochem. 77, 1085 (2001); El Messari, S. et al. J. Neurochem. 90, 1290 (2004); O’Dowd, BF. et al. Gene 136, 355 (1993); Tatemoto, K. et al. Biochem. Biophys. Res. Commun. 251, 471 (1998); Chen, M. et al. Circulation 108, 1432 (2003); Tatemoto, K. et al. Regul. Pept. 99, 87 (2001); Szokodi, I. et al. Circulation Res. 91, 434 (2002); Lee, DK. et al. Endocrinol. 146, 231 (2005). |
|
|
| Product |
Size |
Catalog # |
US$ |
|
[Ala13] - Apelin - 13 QRPRLSHKGPMPA |
1 mg |
61078 |
$93 |
 |
 |
[Pyr1] - Apelin - 13 Pyr - RPRLSHKGPMPF - OH |
1 mg |
60833 |
$77 |
 |
 |
Apelin 12 RPRLSHKGPMPF |
1 mg |
60836 |
$71 |
 |
 |
Apelin - 16, human, bovine FRRQRPRLSHKGPMPF |
1 mg |
63699 |
$99 |
 |
 |
Apelin - 36, human LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
1 mg |
61095 |
$319 |
 |
 |
|
|
|
|
|