About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics
Peptides  >  Apelin Peptides
Apelin, a peptide first isolated from bovine stomach tissue extracts, is the endogenous ligand of the human G protein-coupled orphan APJ receptor. The ligand was named ”apelin” after APJ endogenous ligand. The two major isoforms are apelin-13 and apelin 36. Apelin and APJ are widely expressed in homogenates from animal organs in a pattern shared with angiotensinogen and the angiotensin receptor. Apelin is widely distributed in the CNS and periphery, especially in the heart, kidney, lung and mammary glands. Apelin-like immunoreactivity was detected in the adipocytes, gastric mucosa, endothelia and Kupffer cells in the liver. Apelin is a neuropeptide involved in the regulation of body fluid homeostasis and cardiovascular functions. It reduces blood pressure via a nitric oxide–dependent, possibly central mechanism, exerting a stronger positive inotropic effect on a molar basis (EC50 33 pmol/L) than any agent yet described.

Ref: Hosoya, M. et al. J. Biol. Chem. 275, 21061 (2000); Reaux, A. et al. J. Neurochem. 77, 1085 (2001); El Messari, S. et al. J. Neurochem. 90, 1290 (2004); O’Dowd, BF. et al. Gene 136, 355 (1993); Tatemoto, K. et al. Biochem. Biophys. Res. Commun. 251, 471 (1998); Chen, M. et al. Circulation 108, 1432 (2003); Tatemoto, K. et al. Regul. Pept. 99, 87 (2001); Szokodi, I. et al. Circulation Res. 91, 434 (2002); Lee, DK. et al. Endocrinol. 146, 231 (2005).
 Product Size Catalog # US$  
[Ala13] - Apelin - 13
QRPRLSHKGPMPA
1 mg 61078 $93
[Pyr1] - Apelin - 13
Pyr - RPRLSHKGPMPF - OH
1 mg 60833 $77
Apelin 12
RPRLSHKGPMPF
1 mg 60836 $71
Apelin - 16, human, bovine
FRRQRPRLSHKGPMPF
1 mg 63699 $99
Apelin - 36, human
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
1 mg 61095 $319
  < Back