Osteocalcin Fragments

Account Login

My Cart

My Custom Reports

My Favorites

Logout

Peptides > Osteocalcin Fragments

Osteocalcin (OC) is a 49 amino acid peptide found exclusively in bone tissue and is highly conserved among species. It is a vitamin K- and D-dependent protein produced by osteoblasts, osteocytes and odontoblasts. It is deposited in extracellular bone matrix and is found in the serum. Serum osteocalcin, hydrolysed in the kidney and liver, is considered a specific marker of osteoblast activity and bone formation rate. It may be involved in regulation of osteoblast function, regulation of bone turnover and/or mineralization.
Ref: Ivaska, K. et al. J. Biol. Chem. 279, 18361 (2004); Lee, A. et al. Ann. Clin. Biochem. 37, 432 (2000); Price, P. and S. Hishimoto, Proc. Natl. Acad. Sci. USA 77, 2234 (1980); Salisbury, C. and M. Sharif, Ann. Rheum. Dis. 56, 558 (1997).

Product	Size	Catalog #	US$
[Gla17,21,24] - Osteocalcin (1 - 49) YLYQWLGAPVPYPDPL - Gla - PRR - Gla - VC - Gla - LNPDCDELA DHIGFQEAYRRFYGPV (Gla=γ - Carboxyglutamic Acid; Disulfide bridge: 23 - 29)	0.1 mg	22829	$115

[Gla17,21,24] - Osteocalcin (1 - 49) YLYQWLGAPVPYPDPL - Gla - PRR - Gla - VC - Gla - LNPDCDELA DHIGFQEAYRRFYGPV (Gla=γ - Carboxyglutamic Acid; Disulfide bridge: 23 - 29)	0.5 mg	22830	$335

[Gla17,21,24] - Osteocalcin (1 - 49) YLYQWLGAPVPYPDPL - Gla - PRR - Gla - VC - Gla - LNPDCDELA DHIGFQEAYRRFYGPV (Gla=γ - Carboxyglutamic Acid; Disulfide bridge: 23 - 29)	1 mg	22831	$721

Des - gamma - carboxylated Osteocalcin/Bone Gla Protein YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRF YGPV (Disulfide bridge:C23 - 29)	0.25 mg	65307-025	$175

< Back