Peptides  >  Apoptosis Peptides
 Product Size Catalog # US$  
[Lys(Ac)373] - p53 (368 - 393), p53 K373(Ac), biotin - labeled, human
Biotin - KGGHLKSK - K(Ac) - GQSTSRHKKLMFKTEGPDSD - NH2
1 mg AS-64865-1 $385
[Lys(Ac)373] - p53 (368 - 393), p53 K373(Ac), biotin - labeled, human
Biotin - KGGHLKSK - K(Ac) - GQSTSRHKKLMFKTEGPDSD - NH2
0.25 mg AS-64865-025 $137
Antennapedia Bak BH3 (Ant - BH3) (71 - 89) Fusion peptide
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
1 mg AS-62262 $281
Bak BH3 (69 - 93)
STMGQVGRQLAIIGDDINRRYDSEF
1 mg AS-62272 $198
Bax BH3 peptide (55 - 74), wild type
STKKLSECLKRIGDELDSNM
1 mg AS-62266 $121
Bid BH3, Peptide II, TAMRA labeled
5 - TAMRA - EDIIRNIARHLAQVGDSMDR
1 mg AS-62277 $181
Bid BH3 - R8
RRRRRRRRGEDIIRNIARHLAQVGDSMDR
1 mg AS-62057 $231
Biotin - Caspase 1 Inhibitor II
Biotin - YVAD - CMK
1 mg AS-60841 $55
Caspase 1 (ICE) Inhibitor I
Ac - YVAD - CHO
5 mg AS-25277-5 $242
Caspase 1 (ICE) Substrate 1m, fluorogenic
Ac - YEVD - AMC
5 mg AS-25267-5 $154
Caspase 1 (ICE) Substrate 2, chromogenic
Ac - YVAD - pNA
5 mg AS-25259-5 $105
Caspase 1 (ICE) Substrate 2f, fluorogenic
Ac - YVAD - AFC
5 mg AS-25271-5 $181
Caspase 1 (ICE) Substrate 2f, fluorogenic
Ac - YVAD - AFC
25 mg AS-25271-25 $726
Caspase 1 (ICE) Substrate 2m, fluorogenic
Ac - YVAD - AMC
25 mg AS-25261-25 $605
Caspase 1 (ICE) Substrate 2m, fluorogenic
Ac - YVAD - AMC
5 mg AS-25261-5 $154
Caspase 1 (ICE) Substrate 2r, fluorogenic
(Ac - YVAD)2 - Rh110
1 mg AS-60310-1 $154
Caspase 1 (ICE) Substrate 3f, fluorogenic
Ac - WEHD - AFC
5 mg AS-25285-5 $181
Caspase 1 (ICE) Substrate 3f, fluorogenic
Ac - WEHD - AFC
25 mg AS-25285-25 $726
Caspase 1 (ICE) Substrate 3m, fluorogenic
Ac - WEHD - AMC
25 mg AS-25275-25 $605
Caspase 1 Inhibitor 1 mg AS-60856 $55
Caspase 1 Inhibitor II
Ac - YVAD - CMK
1 mg AS-60840 $66
Caspase 1 Inhibitor IV, Boc - D - CMK
Boc - D(OBzl) - CMK
5 mg AS-60864 $33
Caspase 1 Substrate III
Ac - WEHD - pNA
1 mg AS-60843 $33
Caspase 2 (ICH - 1) Substrate 1m, fluorogenic
Ac - VDVAD - AMC
5 mg AS-25255-5 $154
Caspase 3 (Apopain) Inhibitor 1
Ac - DEVD - CHO
5 mg AS-25269-5 $231
Caspase 3 (Apopain) Inhibitor 1b
Biotin - DEVD - CHO
5 mg AS-25281-5 $242
Caspase 3 (Apopain) Substrate 1, chromogenic
Ac - DEVD - pNA
5 mg AS-25263-5 $83
Caspase 3 (Apopain) Substrate 1, chromogenic
Ac - DEVD - pNA
25 mg AS-25263-25 $303
Caspase 3 (Apopain) Substrate 1f, fluorogenic
Ac - DEVD - AFC
25 mg AS-25273-25 $726
Caspase 3 (Apopain) Substrate 1f, fluorogenic
Ac - DEVD - AFC
5 mg AS-25273-5 $181
Caspase 3 (Apopain) Substrate 1m, fluorogenic
Ac - DEVD - AMC
5 mg AS-25262-5 $154
Caspase 3 (Apopain) Substrate 1m, fluorogenic
Ac - DEVD - AMC
25 mg AS-25262-25 $605
Caspase 3 (Apopain) Substrate 1r - z, fluorogenic
(Z - DEVD)2 - Rh110
5 mg AS-60304-5 $350
Caspase 4 (ICH - 2) Substrate 1, chromogenic
Ac - LEVD - pNA
25 mg AS-25249-25 $413
Caspase 6 (Mch2) Substrate 1f, fluorogenic
Ac - VEID - AFC
5 mg AS-25272-5 $181
Caspase 6 (Mch2) Substrate 1m, fluorogenic
Ac - VEID - AMC
5 mg AS-25256-5 $154
Caspase 6 (Mch2) Substrate 1r, fluorogenic
(Ac - VEID)2 - Rh110
1 mg AS-60308-1 $154
Caspase 6 (Mch2) Substrate 2, fluorogenic
Mca - VQVDGW - K(Dnp) - NH2
5 mg AS-25284-5 $242
Caspase 6 (Mch2) Substrate 2, fluorogenic
Mca - VQVDGW - K(Dnp) - NH2
25 mg AS-25284-25 $847
Caspase 6 Substrate V, fluorogenic
Ac - VEHD - AFC
1 mg AS-60862 $55
Caspase 8 Substrate 1, chromogenic
Ac - IETD - pNA
5 mg AS-25258-5 $105
Caspase 8 Substrate 1, chromogenic
Ac - IETD - pNA
25 mg AS-25258-25 $413
Caspase 8 Substrate 1f, fluorogenic
Ac - IETD - AFC
25 mg AS-25270-25 $726
Caspase 8 Substrate 1f, fluorogenic
Ac - IETD - AFC
5 mg AS-25270-5 $181
Caspase 8 Substrate 1f - z, fluorogenic
Z - IETD - AFC
5 mg AS-60324-5 $154
Caspase 8 Substrate 1m, fluorogenic
Ac - IETD - AMC
5 mg AS-25257-5 $154
Caspase 8 Substrate 1m, fluorogenic
Ac - IETD - AMC
25 mg AS-25257-25 $605
Caspase 8 Substrate 1r - z, fluorogenic
(Z - IEHD)2 - Rh110
5 mg AS-60312-5 $237
Caspase 8 Substrate 1r - z, fluorogenic
(Z - IETD)2 - Rh110
1 mg AS-60312-1 $154
Caspase 9 Substrate 1, chromogenic
Ac - LEHD - pNA
5 mg AS-25278-5 $105
Caspase 9 Substrate 1, chromogenic
Ac - LEHD - pNA
25 mg AS-25278-25 $413
Caspase 9 Substrate 1f, fluorogenic
Ac - LEHD - AFC
25 mg AS-25276-25 $726
Caspase 9 Substrate 1f, fluorogenic
Ac - LEHD - AFC
5 mg AS-25276-5 $181
Caspase 9 Substrate 1r, fluorogenic
(Ac - LEHD)2 - Rh110
1 mg AS-60306-1 $154
Caspase 9 Substrate 1r, fluorogenic
(Ac - LEHD)2 - Rh110
5 mg AS-60306-5 $215
Caspase 9 Substrate 2m, fluorogenic
Ac - LEHD - AMC
5 mg AS-25286-5 $181
Caspase 9 Substrate 2m, fluorogenic
Ac - LEHD - AMC
25 mg AS-25286-25 $726
ICE Inhibitor I, cell permeable
Ac - AAVLPAVLLALLAPYVAD - CHO
1 mg AS-60845 $154
LKKTETQ, Actin - Binding Domain
LKKTETQ
1 mg AS-63782 $71
PR39, Anti - Apoptotic Factor
RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP
0.5 mg AS-63688-05 $264
Pro - apoptotic Peptide, klaklakklaklak, 5 - FAM - labeled
5 - FAM - klaklakklaklak - NH2
1 mg AS-62206 $242
Proapoptotic Peptide, (klaklak)2
klaklakklaklak - NH2
1 mg AS-62199 $110
PUMA BH3
EEQWAREIGAQLRRMADDLNAQYER
1 mg AS-62404 $198
RGD - targeted Proapoptotic Peptide
ACDCRGDCFC - GG - klaklakklaklak - NH2 (S - S bonded C1 - C4 & C2 - C3)
1 mg AS-62207 $363
SensoLyte® 520 Generic Caspase Assay Kit *Fluorimetric*  NEW 1 kit AS-72211 $435
SensoLyte® AFC Caspase Profiling Kit *Fluorimetric* 1 kit AS-71116 $627
SensoLyte® AFC Caspase Substrate Sampler Kit *Fluorimetric* 1 kit AS-71117 $501
SensoLyte® AMC Caspase Profiling Kit *Fluorimetric* 1 kit AS-71120 $627
SensoLyte® AMC Caspase Substrate Sampler Kit *Fluorimetric* 1 kit AS-71121 $501
SensoLyte® Homogeneous AFC Caspase - 8 Assay Kit
200 assays (96 - well plate)
1 kit AS-72088-200 $374
SensoLyte® Homogeneous AFC Caspase - 8 Assay Kit
100 assays (96 - well plate)
1 kit AS-72088-100 $247
SensoLyte® Homogeneous AMC Caspase - 3/7 Assay Kit
500 assays (96 - well plate)
1 kit AS-71118 $272
SensoLyte® Homogeneous Rh110 Caspase - 3/7 Assay Kit
500 assays (96 - well plate)
1 kit AS-71141 $272
SensoLyte® Homogeneous AFC Caspase - 3/7 Assay Kit
500 assays (96 - well plate)
1 kit AS-71114 $272
Smac N7 Protein
AVPIAQK
1 mg AS-60621 $115
Smac/Diablo Peptide [AVPIAQKSE], 5 - FAM labeled
AVPIAQKSEK - K(5 - FAM) - NH2
1 mg AS-64758 $220
Z - DEVD - AFC 25 mg AS-21685-25 $726
Z - DEVD - AFC 5 mg AS-21685-5 $181
Z - DEVD - AMC
Z - DEVD - AMC
5 mg AS-60303-5 $181
  < Back