Peptides  >  Ion Channel Peptides
 Product Size Catalog # US$  
GALA, Pore - Forming Peptide
WEAALAEALAEALAEHLAEALAEALEALAA
1 mg AS-62311 $237
Prostatin (CAP1) Substrate, fluorogenic
Ac - KHYR - AMC
1 mg AS-64803 $121
Ryanodine receptor 1 (RyR1) (3614 - 3643); Calmodulin Binding Peptide (CaMBP)
KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
1 mg AS-64606 $220
SCpanx, Pannexin 1, Scrambled
FSVYWAQADR - NH2
1 mg AS-64387 $71
  < Back