Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptide Fragments
 Product Size Catalog # US$  
Beta - Amyloid (1 - 9), Human
DAEFRHDSG
1 mg 61970 $71
Beta - Amyloid (1 - 9) - Lys(Biotin - LC) - NH2, Human
DAEFRHDSG - K(Biotin - LC) - NH2
1 mg 61973 $105
Beta - Amyloid (1 - 10), Human
DAEFRHDSGY
1 mg 64478 $61
Beta - Amyloid (1 - 10) - GG - K(Biotin), Human
DAEFRHDSGYGG - K(Biotin)
1 mg 62134 $121
Beta - Amyloid (1 - 11), Human
DAEFRHDSGYE
1 mg 22819 $71
Beta - Amyloid (1 - 12), Human
DAEFRHDSGYEV
1 mg 62967 $83
Cys - beta - Amyloid (1 - 12), Human
CDAEFRHDSGYEV
1 mg 64353 $105
Beta - Amyloid (1 - 12) - Cys, Human
DAEFRHDSGYEVC
1 mg 65155 $71
Beta - Amyloid (1 - 13), Human
DAEFRHDSGYEVH
1 mg 64480 $83
Beta - Amyloid (1 - 14), Human
DAEFRHDSGYEVHH
1 mg 64484 $88
Beta - Amyloid (1 - 15), Human
DAEFRHDSGYEVHHQ
1 mg 61798 $93
Beta - Amyloid (1 - 15) - Lys16(HiLyte™ Fluor 488), Human 0.5 mg 62002-05 $237
ClearPoint™ beta - Amyloid (1 - 15), 13C, 15N - Arg, Human
DAEF - R* - HDSGYEVHHQ [R*=R(U - 13C6, U - 15N4)]
0.05 mg 64495 $105
Beta - Amyloid (1 - 16), Human
DAEFRHDSGYEVHHQK
1 mg 24225 $83
Beta - Amyloid (1 - 16), Human
DAEFRHDSGYEVHHQK
5 mg 24226 $341
Beta - Amyloid (1 - 16) - Lys(Biotin - LC) - NH2, Human
DAEFRHDSGYEVHHQK - K(Biotin - LC) - NH2
1 mg 62136 $181
Beta - Amyloid (1 - 17), Human
DAEFRHDSGYEVHHQKL
1 mg 61955 $110
Beta - Amyloid (1 - 17) - Cys, Human
DAEFRHDSGYEVHHQKLC
1 mg 62473 $121
Beta - Amyloid (1 - 17), HiLyte™ Fluor 488 - labeled, Human
HiLyte™ Fluor 488 - DAEFRHDSGYEVHHQKL
0.1 mg 62953 $115
Beta - Amyloid (1 - 20), Human
DAEFRHDSGYEVHHQKLVFF
1 mg 62456 $121
Beta - Amyloid (1 - 22), Human
DAEFRHDSGYEVHHQKLVFFAE
1 mg 62966 $181
Beta - Amyloid (1 - 33), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
0.5 mg 60250-05 $253
Beta - Amyloid (1 - 33), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
1 mg 60250-1 $413
Beta - Amyloid (1 - 34), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
0.5 mg 61799 $176
Beta - Amyloid (1 - 36), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
0.5 mg 60252-05 $264
Beta - Amyloid (1 - 36), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
1 mg 60252-1 $423
Beta - Amyloid (1 - 37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
0.5 mg 60251-05 $264
Beta - Amyloid (1 - 37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
1 mg 60251-1 $423
Beta - Amyloid (1 - 38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
0.5 mg 24233 $154
Beta - Amyloid (1 - 38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
1 mg 24234 $275
ClearPoint™ beta - Amyloid (1 - 38), 13C - Phe & Ile, Human
DAEFRHDSGYEVHHQKLV - *F - *F - AEDVGSNKGA - *I - *I - GLMVGG *F=Phe(U - 13C9), *I=Ile(U - 13C6)
0.05 mg 65220 $117
Beta - Amyloid (1 - 39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
0.5 mg 24295 $181
Beta - Amyloid (1 - 39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
1 mg 24296 $335
Beta - Amyloid (1 - 41), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVI
1 mg 64559 $330
Beta - Amyloid (2 - 16), Human
AEFRHDSGYEVHHQK
1 mg 64794 $83
Beta - Amyloid (2 - 16) - Lys(Biotin - LC) - NH2, Human
AEFRHDSGYEVHHQK - K(Biotin - LC) - NH2
0.5 mg 64154 $99
Beta - Amyloid (3 - 16), Human
EFRHDSGYEVHHQK
1 mg 64793 $77
Beta - Amyloid (3 - 16) - Lys(Biotin - LC) - NH2, Human
EFRHDSGYEVHHQK - K(Biotin - LC) - NH2
0.5 mg 64155 $93
Beta - Amyloid (4 - 13), Human
FRHDSGYEVH
1 mg 62954 $77
Beta - Amyloid (4 - 16) - Lys(Biotin - LC) - NH2, Human
FRHDSGYEVHHQK - K(Biotin - LC) - NH2
0.5 mg 64156 $83
Beta - Amyloid (4 - 24), Human
FRHDSGYEVHHQKLVFFAEDV
1 mg 62961 $176
Beta - Amyloid (4 - 16) - Lys(Biotin - LC) - NH2, Human
FRHDSGYEVHHQK - K(Biotin - LC) - NH2
0.5 mg 64156 $83
Beta - Amyloid (6 - 17), Human
HDSGYEVHHQKL
1 mg 64479 $77
Beta - Amyloid (6 - 30), Human
HDSGYEVHHQKLVFFAEDVGSNKGA
1 mg 62888 $203
Beta - Amyloid (10 - 20), Human
YEVHHQKLVFF
0.5 mg 25364 $39
Beta - Amyloid (10 - 20), Human
YEVHHQKLVFF
1 mg 25365 $61
Beta - Amyloid (10 - 26), Human
YEVHHQKLVFFAEDVGS
1 mg 62885 $105
Beta - Amyloid (10 - 35) - Lys(Biotin) - NH2, Human
YEVHHQKLVFFAEDVGSNKGAIIGLM - K(Biotin) - NH2
0.1 mg 63745 $121
Beta - Amyloid (11 - 17), Human
EVHHQKL
1 mg 63819 $71
Beta - Amyloid (11 - 22), Human
EVHHQKLVFFAE
1 mg 23956 $99
DABCYL - beta - Amyloid (11 - 22) - EDANS, Human
DABCYL - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - EDANS
1 mg 23551 $264
Beta - Amyloid (11 - 25), Human
EVHHQKLVFFAEDVG
1 mg 62884 $93
Beta - Amyloid (13 - 28), Human
HHQKLVFFAEDVGSNK
1 mg 61802 $99
Biotin - LC - beta - Amyloid (15 - 25), Human, mouse/rat
Biotin - LC - QKLVFFAEDVG
1 mg 62907 $115
Beta - Amyloid (15 - 36), Human, mouse/rat
QKLVFFAEDVGSNKGAIIGLMV
1 mg 62023 $242
Beta - Amyloid (16 - 20), Human, mouse/rat
KLVFF
1 mg 60229-1 $61
Beta - Amyloid (16 - 20), Human, mouse/rat
KLVFF
5 mg 60229-5 $242
Beta - Amyloid (16 - 20), HiLyte™ Fluor 555 - labeled, Human, mouse/rat
HiLyte™ Fluor 555 - KLVFF
1 mg 63305 $291
[Ac - Lys(Me)16, N - Me - Val18] - beta - Amyloid (16 - 20) - NH2, Human, mouse/rat
Ac - K(Me) - L - (N - Me - V) - FF - NH2
1 mg 61344 $132
Beta - Amyloid (16 - 22), Human, mouse/rat
KLVFFAE
1 mg 62897 $71
Beta - Amyloid (17 - 24), Human, mouse/rat
LVFFAEDV
1 mg 61978 $71
Biotin - beta - Amyloid (17 - 24), Human, mouse/rat
BIOTIN - LVFFAEDV
1 mg 61980 $83
Beta - Amyloid (22 - 35), Human, mouse/rat
EDVGSNKGAIIGLM
1 mg 22823 $115
Beta - Amyloid (22 - 35), Human, mouse/rat
EDVGSNKGAIIGLM
5 mg 22824 $462
Biotin - LC - beta - Amyloid (22 - 41), Human, mouse/rat
Biotin - LC - EDVGSNKGAIIGLMVGGVVI
1 mg 62455 $198
Beta - Amyloid (25 - 35), Human, mouse/rat
GSNKGAIIGLM
1 mg 24227 $49
Beta - Amyloid (25 - 35), Human, mouse/rat
GSNKGAIIGLM
5 mg 24228 $193
Beta - Amyloid (25 - 35) • HCl, Human, mouse/rat
GSNKGAIIGLM • HCl
1 mg 21647 $77
Beta - Amyloid (25 - 35) • HCl, Human, mouse/rat
GSNKGAIIGLM • HCl
5 mg 23212 $313
Beta - Amyloid (25 - 35), scrambled, Human, mouse/rat
MAKGINGISGL
1 mg 61971 $71
Beta - Amyloid (25 - 35), HiLyte™ Fluor 488 - labeled, Human, mouse/rat
HiLyte™ Fluor 488 - GSNKGAIIGLM
0.1 mg 63308 $110
Biotin - beta - Amyloid (25 - 35), Human, mouse/rat
Biotin - GSNKGAIIGLM
1 mg 62451 $105
Beta - Amyloid (29 - 38), Human, mouse/rat
GAIIGLMVGG
1 mg 62923 $77
Beta - Amyloid (35 - 25), Human, mouse/rat
MLGIIAGKNSG
1 mg 25367 $110
Beta - Amyloid (40 - 1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
0.5 mg 22817 $193
Beta - Amyloid (40 - 1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
1 mg 22818 $325
  < Back