Peptides  >  Amyloid Peptides  >  Amyloid Precursor Protein (APP) / Amyloid Precursor-like Protein (APLP)
 Product Size Catalog # US$  
Amyloid Precursor Protein (APP) (667 - 676)
SEVKMDAEFR
1 mg AS-62065 $61
Amyloid Precursor Protein, (APP) (667 - 676), FRET peptide
Mca - SEVKMDAEFR - Dap(Dnp) - NH2
1 mg AS-62075 $253
Amyloid Precursor Protein, (APP) (721 - 770)
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
0.5 mg AS-63322 $357
Beta - Amyloid A4 Protein Precursor (740 - 770), APP (C31)
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
1 mg AS-62073 $253
  < Back