Peptides  >  Amyloid Peptides  >  Islet Amyloid Polypeptides (IAPP)
 Product Size Catalog # US$  
[NMeG24, NMeI26] Human Islet Amyloid Polypeptide (IAPP) (22 - 27)
NF - (NMe - G) - A - (NMe - I) - L
1 mg 61937 $220
Amylin (1 - 37), rat
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
0.5 mg 60253-05 $303
Amylin (1 - 37), rat
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
1 mg 60253-1 $479
  < Back