ß-Amyloid (1-40) together with ß-Amyloid (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs, with Ab (1-42) being more neurotoxic. These undergo post-secretory aggregation and deposition in the Alzheimer’s diseased brain.^1-5

AnaSpec, EGT Group is pleased to be a provider of a large collection of ß-Amyloid (1-40) peptides:

• Native sequences – human and mouse/rat sequences (unless otherwise specified,
sequences are human in origin)
• Single or multiple amino acid substitution sequences, e.g. S26C
• Biotin labeled sequences – N or C terminally labeled, with or without linker
• Dye labeled sequences – HiLyte Fluor™ or classic dye labeled
• ClearPoint™ heavy-isotope labeled sequences
• Shorter sequences that end on the 40^th amino acid and analog
• HFIP treated ß-Amyloid (1-40)

Figure 1. Comparison of the human and mouse/rat b-amyloid (1-40) sequences.

Table 1. A listing of b-amyloid (1-40) and related peptides. Shaded row denotes that the peptide sequence is of mouse/rat origin (unless otherwise specified, all Aß peptides are of human origin).

Product	Size	Catalog #
Beta - Amyloid (1 - 40) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV	0.5 mg 1 mg 5 mg 25 mg 100 mg	24235 24236 24236-5 24236-25 24236-100
Beta - Amyloid (1 - 40) • HCl DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV • HCl	0.5 mg 1 mg	23211 20698
Scrambled - beta - Amyloid (1 - 40) AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA	0.5 mg 1 mg	24625 24626
Beta - Amyloid (40 - 1) • HCl VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD • HCl	0.5 mg 1 mg	21795 21797
[Cys26] - beta - Amyloid (1 - 40), S26C beta - Amyloid (1 - 40) DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV	0.5 mg 1 mg	63671-05 63671-1
Biotin-labeled beta - Amyloid (1 - 40) & related peptides
ClearPoint™ heavy-isotope labeled beta - Amyloid (1 - 40) & related peptides
Beta - Amyloid Peptide (1 - 40), mouse, rat DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV	0.5 mg 1 mg	25380 25230
Full listing of b-Amyloid (1-40) Peptides
Full listing of b-Amyloid Peptides

Related Products

Peptides
Beta-Amyloid (1-28) and Related Peptides
Beta-Amyloid (1-42) and Related Peptides
Beta-Amyloid (1-43) to (1-49) and (1-55) Peptides
Beta-Amyloid Peptide Fragments
Beta-Amyloid Peptides - Mouse/Rat
Amyloid Toxicity Inhibitor Peptides
Amyloid Precursor Protein (APP) / Amyloid Precursor-like Protein (APLP)
Collagen-like Alzheimer Amyloid Plaque Component Precursor (CLAC-P)
Islet Amyloid Polypeptides (IAPP)
Humanins
Other Amyloid Related Peptides

Antibodies
Anti-β-Amyloid (1-40) & (1-42) mAbs
Anti-Tau, phospho & non-phospho

Assay Kits

SensoLyte^® b-Amyloid (1-40) or (1-42) ELISA Assay Kits
SensoLyte^®a-Secretase (TACE) Assay Kits
SensoLyte^® Calpain Assay Kits
SensoLyte^® Cathepsin B Assay Kits
SensoLyte^® Cathepsin D Assay Kits

References:

1. Masters, CL. et al. Proc Natl Acad Sci USA 82, 4245 (1985).
2. Yankner, BA. Neuron 16, 921 (1996).
3. Geula, C. et al. Nat Med 4, 827 (1998).
4. Shin, R. et al. J Neurosci 17, 8187 (1997).
5. Suzuki, N. et.al. Science 264, 1336 (1994).