Tau Products - Antibodies, Recombinant Proteins and Peptides
Tau Products Antibodies, Recombinant Proteins and Peptides

Tau is a microtubule-associated protein that stabilizes and promotes microtubule assembly. In the human brain, it is present in six isoforms that are 352, 381, 383, 410, 412, and 441 amino acids in length.1-5 When Tau is hyperphosphorylated, it can detach and form paired helical filament (PHF) aggregates.2-5 PHFs were found in neurofibrillary tangles in Alzheimer's disease (AD) patients. As such, hyperphosphorylation of Tau has been linked to AD. In addition to being modified with phosphate groups, Tau can also undergo glycosylation on the same regions where phosphorylation takes place.5 Discovery of this phenomenon has led to the hypothesis that glycosylation of Tau may help stabilize microtubule-Tau connection and prevent free Tau aggregation.



Anti-Tau Antibody (Acetyl K280) & Anti-Tau Antibody (K280)

In support of AD and tauopathy research, AnaSpec is pleased to announce the release of two new polyclonal antibodies - Anti-Tau (Acetyl K280) and Anti-Tau (K280) antibodies. Acetylation of Tau at lysine 280 (K280) is a pathological modification in Tau-mediated neurodegeneration. This modification results in reduced solubility and microtubule assembly. It also increases Tau aggregation (2, 3).6-7 Studies have also shown that a single amino acid deletion (ΔK280) in tau protein promotes tau aggregation in vitro and in vivo.8-9

Anti-Tau Antibody (Acetyl K280)

Anti-Tau Antibody (K280)

Tau antibody acetylK280 dot blot
Tau antibody acetylK280 WB
Tau antibody K280 dot blot
Tau antibody K280 WB
Fig. 1. Top: Dot blot of rabbit anti-Tau (Acetyl K280) polyclonal antibody using synthetic peptides: Tau (Acetyl K280), Tau (K280) dotted at 0.02, 0.2 and 1 µg. Bottom: WB of recombinant Tau proteins using rabbit anti-Tau (Acetyl K280) polyclonal antibody. M: Marker. Lane 1: Recombinant Tau protein acetylated by p300 enzyme. Lane 2: Recombinant Tau protein. Fig. 2. Top: Dot blot of rabbit anti-Tau (K280) polyclonal antibody using synthetic peptides: Tau (Acetyl K280), Tau (K280) dotted at 0.02, 0.2 and 1 µg. Bottom: WB of mouse brain lysate and recombinant Tau proteins using rabbit anti-Tau (K280) polyclonal antibody. M: Marker. Lane 1: Mouse brain lysate. Lane 2: Recombinant Tau protein acetylated by p300 enzyme. Lane 3: Recombinant Tau protein.

Table 1. Anti-Tau rabbit polyclonal antibodies, Acetyl K280 and K280.

Product

Size

Catalog #

Anti-Tau Antibody (Acetyl K280) NEW

50 µg

Anti-Tau Antibody (K280) NEW

50 µg

56078




Anti-Tau Antibody (GlcNAc Ser400) & Anti-Tau Antibody (Ser400)

AnaSpec offers a polyclonal antibody that recognizes the glycosylated [N-acetyl-D-glucosamine (GlcNAc)] Serine400 residue. Anti-Tau Antibody (GlcNAc Ser400) was raised against a synthetic peptide derived from amino acids surrounding the Tau Ser400 sequence. As confirmed by Western and dot blots, this antibody only recognizes Tau glycosylated Ser400 and not the non-glycosylated Tau. Another polyclonal antibody, Anti-Tau (Ser400). This antibody recognizes all Tau modifications including phosphorylation and glycosylation.Species reactivity for both antibodies includes human, monkey, mouse, rat and other mammalian species.

Fig. 3. Recombinant Tau (2N4R) and rat brain lysate were probed with Anti-Tau (GlcNAc Ser 400) antibody. Secondary Goat Anti-Rabbit IgG-HiLyte™ Fluor 750 labeled antibody (Cat# 61056-05-H750 or 61056-1-H750) was used. Multiple immunoreactive bands were detected for rat brain lysate and none for recombinant Tau (as expected).
Fig. 4. Tau (GlcNAc Ser 400) and non-glycosylated immunizing tau peptides was probed with Anti-Tau (GlcNAc Ser 400) antibody. Secondary Goat Anti-Rabbit IgG-HiLyte™ Fluor 750 labeled antibody (Cat# 61056-05-H750 or 61056-1-H750) was used. This antibody does not react with "naked" Tau peptide.
Fig. 5. Recombinant Tau (2N4R) and rat brain lysate were probed with Anti-Tau (Ser 400) antibody. Secondary Goat Anti-Rabbit IgG-HiLyte™ Fluor 750 nm labeled antibody (Cat# 61056-05-H750 or 61056-1-H750) was used to visualize. Multiple immunoreactive bands were detected for rat brain lysate and single band was detected for recombinant Tau (as expected).

Table 2. Anti-Tau rabbit polyclonal antibodies, GlcNAc Ser400 and Ser400.

Product

Size

Catalog #

Anti-Tau Antibody (GlcNAc Ser400) NEW

50 µg

Anti-Tau Antibody (Ser400) NEW

50 µg

55944

Related Product:

[Ser(OGlcNAc)]400-KWK-Tau (388-411)-KK(Biotin)-NH2 Peptide, 65409-025 (0.25 mg) & 65409-1 (1 mg)

Anti-Tau - Phospho & Non-Phospho Specific Antibodies

Table 3. AnaSpec offers a wide selection of Tau Antibodies (phospho & non-phospho specific). All antibodies, except for cat# 53884, are polyclonal antibodies.

Product

50 ug

25 ug

Anti-Tau, monoclonal antibody

53884

NA

Anti-Tau (pThr181)

54960

54960-025

Anti-Tau (Thr181/Ser184)

54961

54961-025

Anti-Tau (pSer184)

55413

55413-025

Anti-Tau (pSer195)

55414

55414-025

Anti-Tau (Ser195)

55460

55460-025

Anti-Tau (pSer198)

54962

54962-025

Anti-Tau (pSer199/202)

54963

54963-025

Anti-Tau (pSer202)

28017

28017-025

Anti-Tau (Ser202)

28018

28018-025

Anti-Tau (pThr205)

54964

54964-025

Anti-Tau (194-214)

54965

54965-025

Anti-Tau (pThr212)

54966

54966-025

Anti-Tau (pSer214)

54967

54967-025

Anti-Tau (pThr217)

54968

54968-025

Anti-Tau (209-226)

54969

54969-025

Anti-Tau (pThr231)

55313

55313-025

Anti-Tau (Thr231)

55415

55415-025

Anti-Tau (pSer235)

55315

55315-025

Anti-Tau (Ser235)

55461

55461-025

Anti-Tau (pSer237)

55321

55321-025

Anti-Tau (Ser237)

55322

55322-025

Anti-Tau (pSer238)

55323

55323-025

Anti-Tau (pSer262)

54973

54973-025

Anti-Tau (Ser262)

54974

54974-025

Anti-Tau (pSer356)

54975

54975-025

Anti-Tau (Ser356)

54976

54976-025

Anti-Tau (pSer396)

54977

54977-025

Anti-Tau (pSer400)

54978

54978-025

Anti-Tau (pSer404)

28023

28023-025

Anti-Tau (Ser404)

28024

28024-025

Anti-Tau (393-411)

54979

54979-025

Anti-Tau (pSer409)

55417

55417-025

Anti-Tau (401-426)

55416

55416-025

Anti-Tau (pSer412)

55418

55418-025

Anti-Tau (pSer413)

55325

55325-025

Related Products:

Anti-Tau Blocking Peptides (phospho & non-phospho)


Tau Peptides

In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat (3R) or four repeat (R4) domains, in addition to the presence or absence of one or two insert domains at the amino-terminus.

Six Tau peptides with sequences from N-terminal inserts and C-terminal repeat domains have recently been released. Shown below is a schematic representation from Tau Peptide (45-73). This is a 29-amino acid long peptide derived from the Exon 2/Insert 1 domain.

Table 4. A listing of recently released Tau peptides.

Product

Size

Catalog #

Tau Peptide (45 - 73) (Exon 2/Insert 1 domain) NEW
ESPLQTPTEDGSEEPGSETSDAKSTPTAE

1 mg

5 mg

65431-1

65431-5

Tau Peptide (74 - 102) (Exon 3/Insert 2 domain) NEW
DVTAPLVDEGAPGKQAAAQPHTEIPEGTT

1 mg

5 mg

65432-1

65432-5

Tau Peptide (244 - 274) (Repeat 1 domain) NEW
Ac-QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK

1 mg

5 mg

65433-1

65433-5

Tau Peptide (275 - 305) (Repeat 2 domain) NEW
VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS

1 mg

5 mg

65434-1

65434-5

Tau Peptide (306 - 336) (Repeat 3 domain) NEW
VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ

1 mg

5 mg

65435-1

65435-5

Tau Peptide (337 - 368) (Repeat 4 domain) NEW
VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN

1 mg

5 mg

65436-1

65436-5

Related Products:

Product

Size

Catalog #

Tau - Protein (1 - 16)
MAEPRQEFEVMEDHAG

1 mg

62959

Tau - Protein (323 - 335)
GSLGNIHHKPGGG

1 mg

62958

β-Amyloid Peptides – Industry's Largest Selection

SensoLyte® β-Amyloid (1-40) & (1-42) ELISA kits – human & mouse/rat

SensoLyte®ThT Aβ42 & Aβ40 Aggregation kits

References:

1. Goedert, M. et al. Neuron, 3, 519 (1989).

2. Evans, DB. et al. JBC 275, 24977 (2000).

3. Luc, B. et al. Brain Res Rev 33, 95 (2000).

4. Arai, T. et al. JBC 280, 5145 (2005).

5. Yuzwa, SA. et al. Amino Acid 40, 857 (2011).

6. Irwin, D. et al. Brain 135, 807 (2012).

7. Cohen, T. et al. Nat Commun 2, 252 (2011).

8. Eckermann, K. et al. J Biol Chem 282, 31755 (2007).

9. Mocanu, M. et al. J Neurosci 28, 737 (2008).