Rare Exendin Peptides are GO™


AnaSpec’s GO Peptides line is pleased to introduce a broad selection of Exendin peptides. Along with a host of popular Exendin peptides, AnaSpec’s GO Peptides line includes Fluorescein-Trp25-Exendin-4 (FLEX) and [Cys(HiLyte™ Fluor 647 C2 maleimide)]-Exendin-4 - two exendin peptides that are not immediately available anywhere else.

Fluorescein-Trp25-Exendin-4 (FLEX) is Exendin-4 with a fluorescein covalently attached to Trp at position 25. Useful for binding and characterization studies of the human GLP-1 receptor, FLEX is equipotent to GLP-1 (7-36)-amide and Exendin-4 as an inhibitor of [125I]-GLP-1 binding to the human GLP-1 receptor stably expressed in CHO cells.1 [Cys(HiLyte™ Fluor 647 C2 maleimide)]-Exendin -4 is Exendin-4 with an additional Cys added to the N-terminus. AnaSpec’s patented HiLyte™ Fluor 647 (Ex/Em=650 nm/675 nm) is attached to the Cys thiol moiety. Please inquire service@anaspec.com if you are interested in Fluorescein-Trp25 Glucagon.

Exendin-3 and Exendin-4 are 39-amino acid peptides from exocrine glands that share about 50% sequence identity to Glucagon-Like-Peptide-1 (GLP-1) and are potent GLP-1R agonists. 2,3 Exendin-3 stimulates increases in cellular cAMP and amylase release from dispersed guinea pig pancreatic acini.4 Exendin-4 was originally isolated from the saliva of the lizard Heloderma suspectum. It is an insulinotropic agent which improves glucose tolerance in humans and animals with diabetes. It increases insulin sensitivity via a PI-3-kinase-dependent mechanism. In the human fetal pancreas, the proliferation and differentiation of endocrine precursor cells into insulin-producing ß-cells can be positively regulated by Exendin-4.5 Exendin-4 is an agonist and Exendin (9-39) is an antagonist of the action of GLP-I (7-36) amide on arterial blood pressure and heart rate.6

GO™ Peptides represent one of the world’s largest selections of premium quality, ready-to-go peptides. Drawing from a well-stocked inventory, GO™ Peptides maintain premium quality without the premium prices and long wait associated with custom peptides.

Click here to request more information.

Product

Size

Catalog #

Exendin 3
HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

0.5 mg

1 mg

24461

24462

Exendin 4
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS- NH2

0.5 mg

1 mg

24463

24464

Biotin-Exendin 4
Biotin-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS- NH2

0.5 mg

1 mg

60279-05

60279-1

Exendin 4, FAM-labeled
FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS- NH2

0.5 mg

1 mg

60280-05

60280-1

Fluorescein-Trp25--Exendin-4 (FLEX) NEW

HGEGTFTSDLSKQMEEEAVRLFIE-(Trp-S-FAM)-LKNGGPSSGAPPPS-NH2

0.5 mg

63899

[Des - His1, Glu8] - Exendin - 4 NEW

GEGTPTSELSKQMEEEAVRLPIEWLKNGGPSSGAPPPS-NH2

1 mg

63900

Exendin 4 (3-39)
EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

0.5 mg

1 mg

24465

24466

Exendin (4-39) NEW
GTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

1 mg

63897

Exendin (5-39) NEW
TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

1 mg

63898

Exendin (7-39) NEW

TSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

1 mg

63902

Exendin (9-39)
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

0.5 mg

1 mg

24467

24468

Exendin (10-39) NEW

LSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

1 mg

63903

[Cys(HiLyte™ Fluor 647 C2 maleimide)]-Exendin-4 NEW
C(HiLyte™ Fluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

50 ug

63714

Trp Cage
NLYIQWLKDGGPSSGRPPPS

1 mg

62072

Glicentin - Related Peptide (21 - 50), human NEW

RSLQDTEEKSRSFSASQADPLSDPDQMNED-NH2

1 mg

63901


























































Related Products:

Agouti Related Peptides

Amylin Peptides

Cholecystokinin-Pancreozymin Peptides

Helodermin

Ghrelins and Obestatins

Glucagon-Like Peptides (GLP)

Growth Hormone Releasing Factors

Neuropeptide Y and Analogs

Oxyntomodulin Peptides

PACAP & PACAP-Related Peptides (PRP)

Pancreatic Polypeptides

Secretins

Vasoactive Intestinal Peptides (VIPs)

Anti-SOCS-3 Antibodies

Anti-Ghrelin

Anti-GHSR Antibodies

Anti-Glucagon

Bulk pricing or modifications of the above products are available. Contact us at service@anaspec.com

References:

1. Chicchi GG. et al. Peptides 18, 319 (1997).
2. Goke, R. et al. J. Biol. Chem. 268, 19650 (1993).
3. Thorens, B. et al. Diabetes 42, 1678 (1993).
4. Eng, J. J. Biol. Chem. 265, 20259 (1990).
5. Movassat, J. et al. J. Clin. Endo. Metab. 87, 4775 (2002).
6. Barragan, JM. Regul. Peptides 67, 63 (1994).