About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics
β-Amyloid Biotin Labeled Peptides are GO™


AnaSpec, the provider of the world’s largest selection of β-amyloid peptides and related products for Alzheimer’s disease (AD) research, is pleased to showcase its β-amyloid peptides labeled with biotin (N or C-terminal biotin labels) as well as N-terminal biotin labeled β-amyloid peptides with a fluorescein label on the C-terminus.

These peptides have been used in different applications. Nelson, TJ and Alkon, DL. used biotin-LC-β-amyloid-(1–42) in Aβ-proteins binding studies.1 Aβ-proteins complex were precipitated with avidin-agarose and western blots run. A paper by Bohrmann, B. et al. reported the use of biotin-Aβ (1-40) or biotin-Aβ (1-42) for their Aβ polymerization studies. 2 Biotin-beta-amyloid (1-40) or biotin-beta-amyloid (1-42) peptides were incubated in Aβ (1-40) or Aβ (1-42) coated plates, and streptavidin-peroxidase added. Color development was done using tetramethyl-benzidin, a chromogenic substrate for peroxidase. In the same paper,2 biotin-beta-amyloid (1-40) incorporation into preformed Aβ (1-42) fibrils was reported. Biotin-Aβ (1-40) was added to a low concentration of Aβ (1-42) fibrils and stained with anti-biotin Ig labeled with colloidal gold and negatively stained with uranyl acetate. A paper by Liu, Y. et al shows the use of biotinylated fibrillar Aβ (1-42) in electron microscopy.3

Using what they called “FAβB,” fluorescein beta-amyloid (1-40)-Lys(LC-biotin), Leissring, MA. et al. performed proteolysis measurement using fluorescence polarization (FP) technique.4

Table 1. A listing of biotin labeled beta-amyloid peptides, green shading denotes beta-amyloid peptides with an amidated C-terminus.

C-Terminal Biotin Label

N-Terminal Biotin Label

Aβ -Lys(biotin)

Aβ-Lys(LC-biotin)

Biotin-Aβ

Biotin-LC-Aβ

Beta-Amyloid (1-9)

61973 (1 mg)

Beta-Amyloid (1-10)

62135 (1 mg)

Beta-Amyloid (1-10)-GG

62134 (1 mg)

Beta-Amyloid (1-12)

62973 (1 mg)

Beta-Amyloid (1-15)

62461 (1 mg)

Beta-Amyloid (1-16)

62136 (1 mg)

62458 (1 mg)

Beta-Amyloid (1-28)

61260 (0.1 mg)

60459 (0.1 mg)

62465 (0.5 mg)

Beta-Amyloid (1-40)

61483-01 (0.1 mg)

61483-05 (0.5 mg)

23518-01 (0.1 mg)

23517 (0.5 mg)

23512-01 (0.1 mg)

23511-05 (0.5 mg)

23512 (1 mg)

24645-01 (0.1 mg)

24648 (0.5 mg)

24645 (1 mg)

Aβ (1-40), mouse, rat

63356 (0.1 mg)

61717-01 (0.1 mg)

61717-05 (0.5 mg)

61717-1 (1 mg)

Beta-Amyloid (1-42)

61484-01 (0.1 mg)

61484-05 (0.5 mg)

23524-01 (0.1 mg)

23523-05 (0.5 mg)

24641-01 (0.1 mg)

24640 (0.5 mg)

Aβ (1-42), mouse, rat

61718-01 (0.1 mg)

61718-05 (0.5 mg)

Beta-Amyloid (2-40)

64221 (1 mg)

Beta-Amyloid (3-42)

61959-01 (0.1 mg)

Beta-Amyloid (4-42)

64223 (1 mg)

Beta-Amyloid (9-42)

62462 (0.5 mg)

Beta-Amyloid (10-20)

62972 (1 mg)

Beta-Amyloid (10-35)

63745 (0.1 mg)

Beta-Amyloid (11-28)

62472 (0.5 mg)

Beta-Amyloid (11-40)

62471 (0.5 mg)

Beta-Amyloid (15-25)

62907 (1 mg)

Beta-Amyloid (15-26)

62469 (0.5 mg)

Beta-Amyloid (17-21)

62467 (1 mg)

Beta-Amyloid (17-24)

61980 (1 mg)

Beta-Amyloid (17-28)

62466 (0.5 mg)

Beta-Amyloid (17-40)

23541-01 (0.1 mg)

23540 (0.5 mg)

23541 (1 mg)

23543-01 (0.1 mg)

24642 (0.5 mg)

23543 (1 mg)

Aβ-(17-40)-KKK

62975 (0.1 mg)

Beta-Amyloid (18-28)

62448 (1 mg)

Beta-Amyloid (22-41)

62455 (1 mg)

Beta-Amyloid (25-35)

62451 (1 mg)

Beta-Amyloid (29-40)

62449 (1 mg)

Beta-Amyloid (29-42)

61986 (1 mg)


Table 2. A listing of N-terminal labeled biotin and C-terminal fluorescein (5-FAM) beta-amyloid (1-40) and beta-amyloid (1-42).

Product

Size

Catalog #

Beta-Amyloid (1-40)-Lys(LC-biotin)-NH2, FAM-labeled, FAβB
5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(LC-BIOTIN)-NH2

0.1 mg

61962-01

Beta-Amyloid (1-40)-Lys(Biotin)-NH2, FAM-labeled
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2

0.1 mg

0.5 mg

23597-01

23596

Beta-Amyloid (1-42)-Lys(Biotin), FAM-labeled
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)

0.1 mg

0.5 mg

23599-01

23598

Custom peptide synthesis is also available, please contact service@anaspec.com

Related Products:

β-Amyloid Peptides, full listing
S26C β-Amyloid Peptides
ClearPoint™ β-Amyloid Peptides – heavy isotope labeled peptides
Beta-Amyloid Peptides (1-44, 1-45, 1-46, 1-47, 1-48 & 1-49)
Labeled Amyloid Peptides
SensoLyte™ 520 Alpha-Secretase Assay Kit
Anti-Tau Antibodies – phospho and non-phosphorylated
DHL™ fluorescent b-Amyloid (1-40) & (1-42) Sampler Kits
Amyloid Vital Dyes

References:

  1. Nelson, TJ. and DL. Alkon, J. Biol. Chem. 282, 31238 (2007).
  2. Bohrmann, B. et al. J. Biol. Chem. 274, 15990 (1999).
  3. Liu, Y. et al. Brain 128, 1778 (2005).
  4. Leissring, MA. et al. J. Biol. Chem. 278, 37314 (2003).