Expanding on its world-class collection of Endothelin peptides,
AnaSpec is pleased to announce the release of new HiLyte Fluor™ 488 and 5-FAM
labeled Endothelin peptides (human, bovine, porcine, rat).
Endothelins (ET) are highly potent vasoconstrictor proteins
distributed throughout all areas of the body, and are implicated in a number
of conditions and diseases.1 Members of the Endothelin family of
peptides consist of Pre-pro-endothelin-1, a biologically inactive precursor
form cleaved by furin covertase to produce Big Endothelin-1 (Big ET-1), which
is cleaved again by endothelin converting enzyme (ECE) between Trp-21 and Val-22
to yield the active ET-1 (1-21). 2 Alternatively, pulmonary chymase
is also capable of generating ET-1 (1-31) by cleaving the Tyr31–Gly32
bond of big ET-1.2, 3 Isoforms include ET-2, ET-3, and ET-4.2
All have two disulfide bonds that hold them in a conical spiral shape.2
In addition to their vasoconstrictive properties, endothelins have inotropic
and mitogenic properties.2 They influence salt and water balance,
affect intracellular Ca2+ concentrations and signal transduction cascades, contract
non-vascular smooth muscle, alter central and peripheral sympathetic activity,
and stimulate the renin-angiotensin-aldosterone system.2-5
ETs are normally kept at stable levels in healthy individuals,
but can become overexpressed, leading to high blood pressure, kidney disease,
and numerous cardiovascular diseases such as pulmonary hypertension, cardiac
hypertrophy, myocardial infarction, heart failure, and cerebral vasospasm.1,
2 ET disregulation is also a key component of tumorigenesis in several
types of cancer.6
Fluorescently labeled endothelins have various applications in ET-related
disease research. They are utilized as probes in visualizing intracellular processes
and molecular interactions between ET-1 and potential ET-antagonists or inhibitors
at the cellular level.7 They are also used for localizing and monitoring
ECE activity and ET-receptor binding affinity via fluorescence fluctuation spectroscopy.8,
9 Specific ET isoform binding sites throughout the body may be studied
using labeled ET. In addition, flow cytometry is used in combination with labeled
ET to assay ET-receptor expression during different periods of the cell cycle,
10 and in vivo and in vitro imaging of ET activity
is capable with fluorescent ET.11 Overall, these unique peptides
offer a wide range of approaches to further study ET function and ET-related
mechanisms.
Table 1. Listing of dye-labeled endothelins.
| Product |
Size |
Catalog # |
Big Endothelin-1 (1-38), human, FAM labeled
"FAM-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGS
PRS (Disulfide bridges Cys 1-15, Cys 3-11)" |
0.25 mg
0.5 mg |
64825-025
64825-05 |
Endothelin 1, human, FAM-labeled FAM-CSCSSLMDKECVYFCHLDIIW
(Disulfide bri dge: 1-15 and 3-11) |
0.5 mg
1 mg |
27116
27117 |
Endothelin 2, human, FAM-labeled
FAM-CSCSSWLDKECVYFCHLDIIW
(Disulfide bridge: 1-15 and 3-11) |
0.5 mg
1 mg |
64536-05
64536-1 |
Endothelin 3, human, rat, HiLyte Fluor™ 488 labeled
HiLyte Fluor™488-CTCFTYKDKECVYYCHLDIIW
(Disulfide bridge: 1-15 and 3-11) |
0.25 mg
0.5 mg |
64829-025
64829-05 |
Endothelin 3, human, rat, FAM-labeled
FAM-CTCFTYKDKECVYYCHLDIIW
(Disulfide bridge: 1-15 and 3-11) |
0.25 mg
0.5 mg |
64816-025
64816-05 |
Table 2. Listing of endothelins.
| Product |
Size |
Catalog # |
| Big Endothelin-1 (1-38), human
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS
(Disulfide bridge: 1-15 and 3-11) |
0.5 mg
1 mg |
62946-05
62946-1 |
| Big Endothelin 1 (1-39), porcine
CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS
(Disulfide bridge: 1-15 and 3-11) |
0.25 mg
0.5 mg
1 mg |
20713
20714
20715 |
| Big Endothelin-1 (22-38), human
VNTPEHIVPYGLGSPSRS |
1 mg |
64858 |
| Big Endothelin-1 (22-39), porcine
VNTPEHIVPYGLGSPSRS |
1 mg |
64859 |
| Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW
(Disulfide bridge:1-15 and 3-11) |
0.25 mg
0.5 mg
1 mg |
22859
22860
22861 |
| Ac-[D-Trp16] Endothelin-1 (16-21),
Receptor Antagonist Peptide 1, human
Ac-wLDIIW |
1 mg |
64864 |
| [Ala1,3,11,16]-Endothelin 1, human
ASASSLMDKEAVYFAHLDIIW |
0.5 mg
1 mg |
24321
24322 |
| Endothelin 2, human
CSCSSWLDKECVYFCHLDIIW
(Disulfide bridge:1-15 and 3-11)
|
0.25 mg
0.5 mg
1 mg |
22862
22863
22864 |
| Endothelin-2, mouse
CSCSNWLDKECVYFCHLDIIW
(Disulfide bridge:1-15 and 3-11) |
0.5 mg |
62356 |
| Endothelin 3, human, rat
CTCFTYKDKECVYYCHLDIIW
(Disulfide bridge:1-15 and 3-11) |
0.5 mg
1 mg |
24323
24324 |
| [Tyr123] Prepro Endothelin (110 - 130), amide, human
CQCASQKDKKCWSYCQAGKEI-NH2
(Disulfide bridge:1-15 and 3-11) |
0.5 mg
1 mg |
64815-05
64815-1 |
| BQ123, Cyclo(-wdPvL-), Endothelin
Antagonist
Cyclo(-wdPvL-) |
1 mg |
62357 |
References
1 Palma, BD. et al. Brazilian J. Med. Biol. Res. 35,
75 (2002).
2 Lüscher, T. Circulation 102, 2434 (2000).
3 Fecteau, M. et al. Hypertension 46, 87 (2005).
4 Inoue, A. et al. J. Biol. Chem. 264, 14954 (1989).
5 Highsmith, RF. et al. FASEB J. 9, 1196 (1995).
6 Smith, K. et al. Br. J. Cancer 88, 163 (2003).
7 Boese, G. et al. J. Cardiovasc. Pharmacol. 36, S44
(2000).
8 Heilker, R. et al. Biochem. 43, 9021 (2004).
9 Higuchi, K. et al. J. Biol. Chem. 266, 18352 (1991).
10 Kobayashi, S. et al. J. Biol. Chem. 273, 12584 (1998).
11 Clark, JC. et al. Br. J. Pharmacol. 159, 812 (2010).
|