Cancer Research
  Gastrins

 Product Size Catalog # US$
Gastrin Releasing Peptide, human
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
0.5 mg 24213 $115
Gastrin Releasing Peptide, human
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
1 mg 24214 $193
  < Back