Cancer Research
  Protein Phosphorylation Related Peptides

 Product Size Catalog # US$
Akt Specific Substrate Peptide, Akt/PKB
RPRAATF
1 mg AS-60612 $121
Keratin K18-C
RPVSSAApSVYAGAC
1 mg AS-60214-1 $132
Keratin K18-C
RPVSSAApSVYAGAC
5 mg AS-60214-5 $533
PDKtide, biotin labeled
Biotin-Ahx[protein fragment, 39 aa]
1 mg AS-64224 $385
  < Back