Cancer Research
  Cancer Research Peptides

 Product Size Catalog # US$
[pThr145]-p21 (140-147)
RKRRQ-pT-SM
1 mg 62613 $165
AH1 Sequence (6-14)
SPSYVYHQF
1 mg 64798 $77
Bak BH3 peptide, TAMRA-labeled
5-TAMRA-GQVGRQLAIIGDDINR
1 mg 64590 $237
Bax BH3 peptide (55-74), wild type
STKKLSECLKRIGDELDSNM
1 mg 62266 $121
Bax H2-H3 (53-86), Helix 2-3
DASTKKLSECLKRIGDELDSNMELQRMIAAVDTD
1 mg 62283 $291
Bcl-2 Binding Peptide, Bad BH3 Peptide
LWAAQRYGRELRRMSDEFEGSFKGL
1 mg 64082 $198
Bid BH3-R8
RRRRRRRRGEDIIRNIARHLAQVGDSMDR
1 mg 62057 $231
c-Myc peptide epitope
EQKLISEEDL
1 mg 24194 $22
c-Myc peptide epitope
EQKLISEEDL
5 mg 20590 $99
CKS-17
LQNRRGLDLLFLKEGGL
1 mg 64579 $93
Enhanced Green Fluorescent Protein, EGFP (200-208)
HYLSTQSAL
1 mg 65302 $77
hACC1 (1258-1271), phosphorylated
DSPPQ-pS-PTFPEAGH
1 mg 63851 $181
HER-2/neu pEC2 (420-429)
PDSLRDLSVF
1 mg 64837 $77
IP3 peptide, (Lys)TAMRA labeled
MPRFMDYWEGLN-K(5/6-TMR)
1 mg 61379 $220
Kisspeptin-10 (Kp-10), Metastin (110-119), amide, mouse, rat
YNWNSFGLRY-NH2
1 mg 64684 $55
Kisspeptin-10 (Kp-10), Metastin (45-54)
YNWNSFGLRF-NH2
1 mg 64240 $61
LyP-1, Peptide 2
CGNKRTRGC
1 mg 62170 $121
Melanoma Antigen Family A 9B (223-231), MAGE-9B (223-231)
ALSVMGVYV
1 mg 63906 $83
MUC5AC 3
GT-T*-PSPVPTTSTTSAP
1 mg 61334 $247
MUC5AC, Analog 1
GTTPSPVPTTSTTSAP
1 mg 61329 $99
MUC5AC-13
GTTPSPVPTTST-T*-SAP
1 mg 61333 $247
MUC5AC-3/13
GT-T*-PSPVPTTST-T*-SAP
1 mg 61332 $401
Neuropilin-1 (NRP-1) Antagonist; EG3287
SCKNTDSRCKARQLELNERTCRCDKPRR (Disulfide bridge 2-20 and 9-22)
1 mg 62840-1 $484
Neuropilin-1 (NRP-1) Antagonist; EG3287
SCKNTDSRCKARQLELNERTCRCDKPRR (Disulfide bridge 2-20 and 9-22)
0.5 mg 62840-05 $291
Nuclear Factor (Erythroid-derived 2)like 2 (74-87); Nrf2 (74-87); NFE2L2 (74-87)
LQLDEETGEFLPIQ
5 mg 65341 $280
PDKtide, biotin labeled
Biotin-Ahx[protein fragment, 39 aa]
1 mg 64224 $385
PRAME epitope (PRA300-309) Tumor-associated antigen
ALYVDSLFFL
1 mg 60594-1 $137
Shepherdin (7987)
KHSSGCAFL
1 mg 62748 $71
Thrombospondin-derived Peptide; Cyclic CSVTCG
CSVTCG (S-S Bonded)
1 mg 65371 $95
TRP-2 (180-188)
SVYDFFVWL
1 mg 61058 $93
TRP-2, Tyrosinase-related Protein 2 (181-188)
VYDFFVWL
1 mg 64811 $71
VEGFR2/KDR Antagonist
ATWLPPR
1 mg 60628 $127
WP9QY, TNF-alpha Antagonist
YCWSQYLCY (Disulfide bridge: 2-8)
1 mg 62621 $132
  < Back