Cancer Research
  Cancer Research Peptides

 Product Size Catalog # US$
[pThr145]-p21 (140-147)
RKRRQ-pT-SM
1 mg AS-62613 $165
AH1 Sequence (6-14)
SPSYVYHQF
1 mg AS-64798 $77
Bak BH3 peptide, TAMRA-labeled
5-TAMRA-GQVGRQLAIIGDDINR
1 mg AS-64590 $237
Bax BH3 peptide (55-74), wild type
STKKLSECLKRIGDELDSNM
1 mg AS-62266 $121
Bcl-2 Binding Peptide, Bad BH3 Peptide
LWAAQRYGRELRRMSDEFEGSFKGL
1 mg AS-64082 $198
Bid BH3-R8
RRRRRRRRGEDIIRNIARHLAQVGDSMDR
1 mg AS-62057 $231
c-Myc peptide epitope
EQKLISEEDL
1 mg AS-24194 $22
c-Myc peptide epitope
EQKLISEEDL
5 mg AS-20590 $99
Enhanced Green Fluorescent Protein, EGFP (200-208)
HYLSTQSAL
1 mg AS-65302 $77
hACC1 (1258-1271), phosphorylated
DSPPQ-pS-PTFPEAGH
1 mg AS-63851 $181
HER-2/neu pEC2 (420-429)
PDSLRDLSVF
1 mg AS-64837 $77
IP3 peptide, (Lys)TAMRA labeled
MPRFMDYWEGLN-K(5/6-TMR)
1 mg AS-61379 $220
Kisspeptin-10 (Kp-10), Metastin (110-119), amide, mouse, rat
YNWNSFGLRY-NH2
1 mg AS-64684 $55
Kisspeptin-10 (Kp-10), Metastin (45-54)
YNWNSFGLRF-NH2
1 mg AS-64240 $61
LyP-1, Peptide 2
CGNKRTRGC
1 mg AS-62170 $121
MUC5AC 3
GT-T*-PSPVPTTSTTSAP
1 mg AS-61334 $247
MUC5AC, Analog 1
GTTPSPVPTTSTTSAP
1 mg AS-61329 $99
MUC5AC-13
GTTPSPVPTTST-T*-SAP
1 mg AS-61333 $247
MUC5AC-3/13
GT-T*-PSPVPTTST-T*-SAP
1 mg AS-61332 $401
Neuropilin-1 (NRP-1) Antagonist; EG3287
SCKNTDSRCKARQLELNERTCRCDKPRR (Disulfide bridge 2-20 and 9-22)
1 mg AS-62840-1 $484
Neuropilin-1 (NRP-1) Antagonist; EG3287
SCKNTDSRCKARQLELNERTCRCDKPRR (Disulfide bridge 2-20 and 9-22)
0.5 mg AS-62840-05 $291
Nuclear Factor (Erythroid-derived 2)like 2 (74-87); Nrf2 (74-87); NFE2L2 (74-87)
LQLDEETGEFLPIQ
5 mg AS-65341 $280
PDKtide, biotin labeled
Biotin-Ahx[protein fragment, 39 aa]
1 mg AS-64224 $385
Shepherdin (7987)
KHSSGCAFL
1 mg AS-62748 $71
Thrombospondin-derived Peptide; Cyclic CSVTCG
CSVTCG (S-S Bonded)
1 mg AS-65371 $95
TRP-2 (180-188)
SVYDFFVWL
1 mg AS-61058 $93
TRP-2, Tyrosinase-related Protein 2 (181-188)
VYDFFVWL
1 mg AS-64811 $71
VEGFR2/KDR Antagonist
ATWLPPR
1 mg AS-60628 $127
WP9QY, TNF-alpha Antagonist
YCWSQYLCY (Disulfide bridge: 2-8)
1 mg AS-62621 $132
  < Back