Alzheimer's Disease
  Signal Transduction Peptides

 Product Size Catalog # US$
[Cys7]-beta-Amyloid (1-40), Human
DAEFRHCSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 62815-1 $423
[Cys7]-beta-Amyloid (1-40), Human
DAEFRHCSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.5 mg 62815-05 $264
Beta-Amyloid (1-12), Human
DAEFRHDSGYEV
1 mg 62967 $83
Beta-Amyloid (1-12)-Lys(Biotin)-NH2, Human
DAEFRHDSGYEV-K(Biotin)-NH2
1 mg 62973 $121
Beta-Amyloid (1-13), mouse, rat
DAEFGHDSGFEVR
1 mg 62978 $110
Beta-Amyloid (1-22), Human
DAEFRHDSGYEVHHQKLVFFAE
1 mg 62966 $181
Beta-Amyloid (1-28), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNK
1 mg 62995 $220
Beta-Amyloid (1-40)-Lys(Biotin)-NH2, mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
0.1 mg 63356 $165
Beta-Amyloid (10-19), Human
YEVHHQKLVF
1 mg 62963 $77
Beta-Amyloid (17-40)-KKK-Lys(Biotin)-NH2, Human, mouse/rat
LVFFAEDVGSNKGAIIGLMVGGVVKKK-K(Biotin)-NH2
0.1 mg 62975 $71
Beta-Amyloid (4-24), Human
FRHDSGYEVHHQKLVFFAEDV
1 mg 62961 $176
Beta-Amyloid (5-40), Human
RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 62964 $325
Tau-Protein (1-16)
MAEPRQEFEVMEDHAG
1 mg 62959 $99
Tau-Protein (323-335)
GSLGNIHHKPGGG
1 mg 62958 $83
  < Back