Alzheimer's Disease
  Signal Transduction Peptides

 Product Size Catalog # US$
Beta-Amyloid (1-12), Human
DAEFRHDSGYEV
1 mg AS-62967 $83
Beta-Amyloid (1-22), Human
DAEFRHDSGYEVHHQKLVFFAE
1 mg AS-62966 $181
Beta-Amyloid (1-40)-Lys(Biotin)-NH2, mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
0.1 mg AS-63356 $165
Beta-Amyloid (4-24), Human
FRHDSGYEVHHQKLVFFAEDV
1 mg AS-62961 $176
Beta-Amyloid (5-40), Human
RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg AS-62964 $325
Tau-Protein (1-16)
MAEPRQEFEVMEDHAG
1 mg AS-62959 $99
Tau-Protein (323-335)
GSLGNIHHKPGGG
1 mg AS-62958 $83
  < Back