Alzheimer's Disease
  Amyloid Precursor Protein (APP) / Amyloid Precursor-like Protein (APLP)

 Product Size Catalog # US$
Amyloid Precursor Protein (APP) (667-676)
SEVKMDAEFR
1 mg 62065 $61
Amyloid Precursor Protein, (APP) (667-676), FRET peptide
Mca-SEVKMDAEFR-Dap(Dnp)-NH2
1 mg 62075 $253
Beta-Amyloid A4 Protein Precursor (740-770), APP (C31)
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
1 mg 62073 $253
  < Back