Alzheimer's Disease
  Amyloid Precursor Protein (APP) / Amyloid Precursor-like Protein (APLP)

 Product Size Catalog # US$
Amyloid Precursor Protein (APP) (44-62)
HMNVQNGKWDSDPSGTKTC
1 mg 61983 $181
Amyloid Precursor Protein (APP) (667-676)
SEVKMDAEFR
1 mg 62065 $61
Amyloid Precursor Protein, (APP) (667-676), FRET peptide
Mca-SEVKMDAEFR-Dap(Dnp)-NH2
1 mg 62075 $253
Amyloid Precursor-Like Protein 1, APLP1 (594-610)
GGGSLIVLSLLLLRKKK
1 mg 62913 $110
Amyloid Precursor-Like Protein 2, APLP2 (706-721)
AIATVIVISLVMLRKR
1 mg 62912 $99
Beta-Amyloid A4 Protein Precursor (740-770), APP (C31)
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
1 mg 62073 $253
Beta-Amyloid Protein Precursor (657-676)
HHGVVEVDAAVTPEERHLSK
0.5 mg 25378 $99
Beta-Amyloid Protein Precursor (657-676)
HHGVVEVDAAVTPEERHLSK
1 mg 25379 $159
Beta-Amyloid Protein Precursor 770 (135-155)
FLHQERMDVCETHLHWHTVAK
1 mg 60236-1 $176
Beta-Amyloid/A4 Protein Precursor (APP) (319-335)
AKERLEAKHRERMSQVM
0.5 mg 25374 $99
Beta-Amyloid/A4 Protein Precursor (APP) (319-335)
AKERLEAKHRERMSQVM
1 mg 25375 $159
Beta-Amyloid/A4 Protein Precursor (APP) (328-332)
RERMS
0.5 mg 25376 $39
Beta-Amyloid/A4 Protein Precursor (APP) (328-332)
RERMS
1 mg 25377 $61
Beta-Amyloid/A4 Protein Precursor (APP) (96-110)
Ac-NWCKRGRKQCKTHPH-NH2 (Disulfide bond: 3-10)
0.5 mg 25372 $99
Beta-Amyloid/A4 Protein Precursor (APP) (96-110)
Ac-NWCKRGRKQCKTHPH-NH2 (Disulfide bond: 3-10)
1 mg 25373 $159
Beta-Amyloid/A4 Protein Precursor 770 (394-410)
AKERLEAKHRERMSQWM
1 mg 60233-1 $105
  < Back