Blood Pressure Control
   Disulfide Cyclized Peptides

 Product Size Catalog # US$
α-Calcitonin Gene Related Peptide, α-CGRP, rat
SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
1 mg 60730 $259
[Arg8]-Vasopressin (AVP)
CYFQNCPRG-NH2 (Disulfide bridge: 1-6)
1 mg 24289 $33
[Arg8]-Vasopressin (AVP)
CYFQNCPRG-NH2 (Disulfide bridge: 1-6)
5 mg 24290 $127
Adrenomedullin (1-52), human
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
0.5 mg 60447 $335
Atrial Natriuretic Peptide (1-28), human, porcine
SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
0.5 mg 20647 $121
Atrial Natriuretic Peptide (1-28), human, porcine
SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
1 mg 20648 $145
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled
Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
0.5 mg 23972 $181
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled
Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
1 mg 23973 $303
Atrial Natriuretic Peptide (1-28), rat
SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
0.5 mg 20651 $121
Atrial Natriuretic Peptide (1-28), rat
SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
1 mg 20652 $150
Big Endothelin 1 (1-39), porcine
CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
1 mg 20715 $583
Biotin-Calcitonin, human
Biotin-CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
0.5 mg 23580 $303
BNP (64-95), rat
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10-26)
1 mg 22931 $385
BNP-32, human
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
0.5 mg 24015 $242
BNP-32, human
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
1 mg 24016 $385
BNP-45 (51-95), rat, 5K Cardiac Natriuretic Peptide
SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
0.5 mg 61153 $303
BNP-45, mouse
SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL (Disulfide bridge:23-39)
0.5 mg 61152 $303
C-Type Natriuretic Peptide (32-53), human, porcine
GLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: 6-22)
1 mg 24244 $220
Calcitonin Gene Related Peptide, CGRP, human
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)
0.5 mg 20681 $154
Calcitonin Gene Related Peptide, CGRP, human
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)
1 mg 20682 $259
Calcitonin, human
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
1 mg 20673 $137
Calcitonin, human
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
5 mg 20674 $577
Calcitonin, rat
CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (Disulfide bridge: 1-7)
5 mg 24205 $577
Calcitonin, salmon
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
1 mg 20677 $121
Calcitonin, salmon
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
5 mg 20678 $484
Endothelin 1, human, FAM-labeled
FAM-CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
0.5 mg 27116 $605
Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
0.25 mg 22859 $181
Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
0.5 mg 22860 $291
Endothelin 1, human, porcine
CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
1 mg 22861 $462
Endothelin 3, human, rat
CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1-15 and 3-11)
0.5 mg 24323 $193
Endothelin 3, human, rat
CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1-15 and 3-11)
1 mg 24324 $341
Orexin A, bovine, human, mouse, rat
Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
0.5 mg 24469 $423
Orexin A, bovine, human, mouse, rat
Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
1 mg 24470 $480
Sarafotoxin 6c
CTCNDMTDEECLNFCHQDVIW (Disulfide bridge: 1-15 and 3-11)
0.5 mg 24325 $193
Sarafotoxin 6c
CTCNDMTDEECLNFCHQDVIW (Disulfide bridge: 1-15 and 3-11)
1 mg 24326 $341
Thr-Ala-Pro-Arg-Atrial Natriuretic Peptide, Urodilatin, human
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 11-27)
1 mg 20650 $264
Urotensin II, human
ETPDCFWKYCV HCl (Disulfide bridge: 5-10)
5 mg 27052 $583
  < Back