Blood Pressure Control
  Natriuretic Peptides

 Product Size Catalog # US$
Atrial Natriuretic Peptide (1-28), human, porcine
SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
0.5 mg AS-20647 $121
Atrial Natriuretic Peptide (1-28), human, porcine
SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
1 mg AS-20648 $145
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled
Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
0.5 mg AS-23972 $181
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled
Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
1 mg AS-23973 $303
Atrial Natriuretic Peptide (1-28), rat
SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
0.5 mg AS-20651 $121
Atrial Natriuretic Peptide (1-28), rat
SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
1 mg AS-20652 $150
BNP (64-95), rat
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10-26)
1 mg AS-22931 $385
BNP-32, human
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
0.5 mg AS-24015 $242
BNP-32, human
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
1 mg AS-24016 $385
BNP-45 (51-95), rat, 5K Cardiac Natriuretic Peptide
SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
0.5 mg AS-61153 $303
BNP-45, mouse
SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL (Disulfide bridge:23-39)
0.5 mg AS-61152 $303
C-Type Natriuretic Peptide (32-53), human, porcine
GLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: 6-22)
1 mg AS-24244 $220
  < Back